KEGG   Bacillus subtilis XF-1: C663_3487Help
Entry
C663_3487         CDS       T02459                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bsx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C663_3487 (rbsK)
Enzymes [BR:bsx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     C663_3487 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3530730..3531578
Genome map
AA seq 282 aa AA seqDB search
MDLVVISDKRPKAGETVLGTSFQTVPGGKGANQAVAAARLGAQVFMVGKVGDDHYGTAIL
NNLKANGVRTDYMEPVTHAESGTAHIVLAEGDNSIVVVKGANDDITPAYALNALEQIEKV
DMVLIQQEIPEETVDEVCKYCHSHDIPIMLNPAPARPLKQETIDHATYLTPNEHEASILF
PELTISEALALYPAKLFITEGKQGVRYSAGSKEVLIPSFPVEPVDTTGAGDTFNAAFAVA
LAEGKDIEAALRFANRAASLSVCSFGAQGGMPTRNEVEELLS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggatttagtagtcatctcggataaacgcccaaaagccggtgaaacggttcttggcacg
tcctttcagactgtgccgggcggcaaaggagcaaatcaggccgttgccgcagccagactt
ggggctcaagtgtttatggtcggcaaggttggagacgatcattatggaacagctattttg
aataatctcaaagctaacggcgttcgcactgactatatggaaccggttacacatgcggaa
agcggaaccgctcatattgtgcttgctgaaggtgataacagcattgtcgttgtcaaaggc
gcgaacgatgacatcaccccagcgtatgcgttaaacgcgctcgaacagattgaaaaggtc
gatatggtgctgattcagcaggaaatcccagaagaaacggttgatgaggtgtgcaaatac
tgccattctcacgatatcccgatcatgctaaacccggcaccggcccgcccgctcaagcag
gaaacaattgatcacgccacctatctgacgccgaatgaacacgaggcttcgattttattc
cctgagcttaccatttctgaagctctggcgctttatccggcaaagctctttattacagaa
ggaaaacaaggcgtccgctattcggctggcagcaaagaagtgctcatcccgtcctttcct
gttgagcccgttgatacaaccggagccggtgatacgtttaacgcagcatttgccgtggcc
ctggctgagggaaaagacattgaagccgcattgcggtttgccaaccgtgccgcttccctt
tctgtctgttccttcggtgcccaaggcggaatgccgacaagaaatgaagtagaggagctg
ctgtcatga

DBGET integrated database retrieval system