KEGG   Bacillus subtilis XF-1: C663_3605Help
Entry
C663_3605         CDS       T02459                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bsx00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3641287..3641874)
Genome map
AA seq 195 aa AA seqDB search
MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVRVFKPVIDNRYSEAAVVSHNG
TSMTSYAISSAADIWDHISESTDVIAVDEVQFFDQEIVEVLSSLADKGYRVIAAGLDMDF
RGEPFGVVPNIMAIAESVTKLQAVCSVCGSPASRTQRLIDGKPASYDDPVILVGASESYE
ARCRHHHEVPGKSKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacataatgaaacaaagcgggtggcttgagctgatttgcggcagcatgttctcgggg
aaatctgaagagctgatcagaagagtgaagagagcgacttacgccaagcaggaagtcagg
gtatttaagcctgtaattgataaccgatacagcgaagctgctgttgtctcccataatgga
acatcgatgacgagctatgccatttcgtctgctgcggacatttgggatcacatcagtgaa
agtacagatgtgattgcggttgatgaagtgcagttttttgatcaggaaattgttgaggtt
ttatcatctcttgccgataaaggctaccgtgtgatagcagcaggccttgatatggatttt
aggggagagccgttcggtgtcgtcccgaatatcatggcgattgcggaaagtgtgacaaag
ctgcaagccgtctgttctgtttgcggatcaccggcgagcagaacacagcgcctcattgac
ggcaaacctgcttcttacgatgatccggtcattttggttggtgcatctgaatcatatgaa
gcaagatgcagacatcatcacgaagtcccaggtaaatctaaaaaatag

DBGET integrated database retrieval system