KEGG   Bacillus subtilis XF-1: C663_3688Help
Entry
C663_3688         CDS       T02459                                 

Gene name
spsL
Definition
spore coat polysaccharide biosynthesis protein (EC:5.1.3.-)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:bsx00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bsx00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3725938..3726399)
Genome map
AA seq 153 aa AA seqDB search
MHVIDGVKVKKLTKHSDDRGFFAELVRDDENLLEHFGQASWSKSYPGVIKAFHYHEKQDD
LWFFPTGHAQVVLYDLREDSKTKGETDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLTII
YFTTMSYNPDQPDEKRIPWNDETIGFNWNTEFR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgtgattgatggagtcaaggtgaaaaaattgacgaagcatagcgatgacagaggc
ttttttgctgagctggtccgggacgatgagaatctccttgagcattttgggcaggcttct
tggtcgaaaagctatccgggtgtgattaaggcatttcattatcatgagaagcaggatgat
ctctggttcttcccaaccggccacgctcaggttgtcctatacgatcttcgagaggattca
aagacaaaaggagaaacggacgtctattatatgggcgaagacaacccgatgctgttatta
atcccaaaaggggtggctcacggatatagagtgctgggagagacgccgctgacaattatc
tattttaccaccatgtcgtataacccggatcagcctgatgaaaaaagaattccgtggaat
gatgagacgatcggttttaactggaacactgaattcagataa

DBGET integrated database retrieval system