KEGG   Bacillus subtilis XF-1: C663_3941Help
Entry
C663_3941         CDS       T02459                                 

Gene name
yycR
Definition
putative dehydrogenase (EC:1.-.-.-)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C663_3941 (yycR)
  Energy metabolism
   00680 Methane metabolism
    C663_3941 (yycR)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C663_3941 (yycR)
Enzymes [BR:bsx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     C663_3941 (yycR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3980353..3981579)
Genome map
AA seq 408 aa AA seqDB search
MGGMTLTGNKAVVYKGNETVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNI
CGSDQHMVRGRTTAPEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCKT
QKTHVCLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDNEQALEKILDLT
MLSDIFPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQ
ARSFGCETVNVQNHDRLGEQIEQILGEPTVDAAVDCVGFEAYGHGNQGEAPAAVLNSIMD
VTQVGGSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLM
KAILSGRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaatgacgttgacaggaaacaaagcggttgtgtacaaaggcaatgaaactgta
gcggtggaggatatcggttatccggagttaatcttaagggacgggcccggcgttccgaag
gcgaatgtgaatcgaaaatgtgagcatggggttattctcaaagtcattacaaccaacatt
tgcggaagcgaccagcatatggtcagaggccgcacaacggcgcctgaaggcttggtgctc
gggcatgaaattacgggagaagtcattgaaacggggcgtgatgttgaatttatcaaaaaa
ggagatatcgtatctgttcctttcaatattgcctgcggacgctgtgtgatgtgcaaaacg
cagaaaacgcatgtgtgcctgaatgtcaatccggaccggccgggatcggcttacggctac
gtcgatatgggtggctgggtcggcggccagtcggaatacgtcatggtgccgtacgctgat
tttcagcttttggtgttccctgataacgaacaggcgttagaaaagattctcgatttgacc
atgctgtccgacattttcccgaccggcttccacggagcttacacagcgggcgtgcaaaca
ggttcaaccgtctatatcgcgggagcggggccagtcggcttagcagccgctcactccgct
cagctcctaggcgcctccaccgtgattgtcggagatctgaacgaagacagactggcacag
gcgagaagcttcggctgtgaaacggtcaacgtacaaaaccacgaccgcctcggcgagcaa
attgaacaaatactaggtgaaccaaccgttgatgccgcagtggactgtgtcggctttgaa
gcatacggacacggcaatcaaggagaagcgcctgccgccgtgctgaactcgatcatggac
gtcacccaggtcgggggcagccttggcattccaggcttatacgtgaccgaagatcccggc
gcaaaggatgcggacgccaaaacaggctcattaaaaatccgcttcggactcggctgggcc
aaagcccacaccttcgtcaccggacaaacgcccgccatgacatacaaccgcaatttgatg
aaagcgattctgagcggcagagcgcaaatcgcaaaagccgtcaacgccactgtcatttct
ttggacgacgcgccaaaaggctacagcgacttcgacaaaggcgcagccaaaaaattcgtc
atcgacccgcatggaacactgaagtaa

DBGET integrated database retrieval system