KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01185Help
Entry
I653_01185        CDS       T02520                                 

Definition
(GenBank) glutaminase (EC:3.5.1.2)
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I653_01185
   00220 Arginine biosynthesis
    I653_01185
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    I653_01185
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     I653_01185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(255076..256059)
Genome map
AA seq 327 aa AA seqDB search
MKELIKEHQKDINPALQLHDWVAYYRPFAANGQSANYIPALGKINDSQLGICVLEPDGTM
IHAGDWNVSFTLQSISKVISFIAACMSRGIPYVLDRVDVEPTGDAFNSIIRLEINKPGKP
FNPMINAGALTIASILPGESAYEKLEFLYSVMETLIGKRPRIHEEVFRSEWETAHRNRAL
AYYLKETNFLEAEVEETLEVYLKQCAMESTTEDIALIGLILAHDGYHPIRREQVIPKDVA
KLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPPSARREQPFQSGCGIGIYGP
AIDEYGNSLTGGMLLKHMAQEWELSIF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattgataaaagagcaccagaaagacataaacccggcgttacagctgcatgat
tgggttgcgtactatcgcccttttgccgccaatggacaaagtgcaaactatatccccgca
ttaggaaaaatcaatgattcacagctcggcatctgtgtattggagcctgatggaacgatg
atacacgccggcgactggaacgtctcttttaccctgcaaagcatttcaaaagtgattagc
tttattgccgcctgcatgagccgcggcattccctatgtgctggaccgcgtagatgtcgag
ccgacaggtgacgcctttaattcaatcattcggctcgaaatcaacaagccgggaaagccc
ttcaatcccatgatcaacgcgggtgccctcaccatcgcttcgatccttcccggagaatcg
gcatacgaaaagctcgagtttctttactcggtgatggaaactttgataggaaaacggccg
agaattcatgaagaagtattccgttctgaatgggaaaccgcccaccgcaacagagcgctg
gcctactatttaaaagaaacaaactttttagaagctgaagtagaagaaacacttgaggtg
tacttgaagcaatgcgctatggagagcactacagaagatattgcattgatcggcctgatc
cttgctcatgacgggtatcatccgattcgacgcgagcaggtgattccaaaagatgtcgca
aaattggccaaggcattaatgctgacgtgcggcatgtacaacgcttcaggcaaatatgcg
gcgtttgtcggcgtgccggccaaaagcggcgtctccggcggcatcatggcgctggtgcct
ccaagcgccagaagagaacagccttttcaatccggatgcggcatcggcatttacgggcct
gccattgatgaatacggcaacagcctcactggcggtatgctgctgaagcatatggcgcag
gaatgggagctcagcattttttaa

DBGET integrated database retrieval system