KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01415Help
Entry
I653_01415        CDS       T02520                                 

Definition
(GenBank) high affinity Zn(II) ABC transporter (permease)
  KO
K09816  
zinc transport system permease protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
ABC transporters
Module
Zinc transport system
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    I653_01415
Transporters [BR:bsy02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter [MD:M00242] [OT]
    I653_01415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
300902..301744
Genome map
AA seq 280 aa AA seqDB search
MEMFDLEFMRRAFLAGGMIAVMAPILGVYLVLRRQALMADTLSHISLSGVAIGFFLSTNI
TAASIVVVTIGAIGIEYMRRAYRTYSEVSIAILMAAGLSFAMFLISLSKGTANMSIDQYL
FGSLVTVNQQQVYIISIITLLILLYFIVLKRPLYLLTFDEATAKTSGINTNVLSLSFSIV
TGLAISVIIPIIGVLLVSALLVLPAAFAIRIAKGFNMVFITAILISLFSVFTGLTSSYQL
GTPPGPSITLLLIVLLLIGFAVQGVWTFIKKEAQRKKRRR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgtttgacttggaattcatgcgacgagcttttctagcaggcggcatgatcgcc
gtcatggctccgatactaggagtgtatctcgttctcagaagacaggccttaatggctgac
acactttcacatatctcattgtcaggtgttgccatcggcttttttctcagcaccaatata
accgcagcaagcatagtcgtcgtgaccatcggcgcaatcggaattgaatacatgcggcgg
gcgtatcggacttattcagaagtgtccattgccatcttgatggcagctggtttgtccttc
gcgatgtttttaatcagcctttcaaaaggcacagccaatatgagcatcgatcaataccta
tttggatcgcttgtgacagtcaaccagcagcaggtctatattatcagtattatcacactg
ctgatcctgctttattttatcgtactgaaaaggccgctctacctgctgacgtttgatgaa
gcaacagccaaaacatcgggaatcaatacaaacgttctctcgttgtcattcagtattgtc
acaggccttgcgatttcagtcattattccgatcatcggggtccttcttgtctcggccctg
ctcgtattgccggcagcattcgccatcagaattgcaaaaggctttaacatggttttcatt
acagccatactcatttcgttattcagtgtatttacgggactgacatcatcctatcagctc
gggacgccgccaggtccgtctattaccctgctattgatcgttttgctattaatcggattt
gcagttcagggagtttggacgtttatcaaaaaagaagctcagcgcaaaaaaaggcgccga
taa

DBGET integrated database retrieval system