KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01440Help
Entry
I653_01440        CDS       T02520                                 

Definition
(GenBank) putative stress adaptation transporter
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
304928..305701
Genome map
AA seq 257 aa AA seqDB search
MDFLHHILSTYASFFDWKMWGEVLTDPVSWGLIGSLVVLEGLLSADNALVLAVMVKHLPE
KQRKKALTYGLFGAYIFRFIFIGLGMLLIKFWWIKVLGALYLAWLVIKHFWIGEKEEEAD
GMKKNSWMVRTFGIFWATVISVELMDLAFSVDSILAAFAVSEKVWVLLIGGMLGILMMRT
VAKVFLVLIDKIPELENTAFVLIGIIALKMAGSAFHYEMPHSVFFIIIIAAFAVTLIIHY
INKQKQVREQTAASKEE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttggactttttacatcatattttgtctacgtatgcttcatttttcgattggaaaatgtgg
ggggaagttctgactgatcctgtttcttggggtttgatcggttcccttgttgttctggaa
ggccttttatcggccgataacgcgcttgttcttgcggtcatggttaaacacctgccggaa
aaacagcggaaaaaagcgttaacgtatggtttgtttggagcttatattttcaggtttatt
ttcatcgggctcggtatgcttctcattaaattctggtggatcaaggtgcttggcgcgctt
tacctggcttggctcgtcattaagcacttctggataggcgaaaaagaagaggaagcggac
ggcatgaagaaaaactcttggatggtccgcacgttcgggatcttctgggcgactgtcatt
tcagtagaattaatggatcttgccttctctgtggacagcatcctggccgcgtttgcagta
tctgaaaaagtatgggtgcttctgatcggcggtatgcttggtattttaatgatgcgtaca
gtggcaaaagtgttccttgtgctgattgataaaattcctgagctggaaaacacagcattc
gtcttaatcggcattatcgcgctgaaaatggcggggagcgctttccattacgaaatgccg
cactccgtattcttcatcatcattatcgctgcatttgcggtaacattgattattcactac
atcaataaacaaaagcaggtgcgcgaacaaacagccgcttcaaaagaagaataa

DBGET integrated database retrieval system