KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01455Help
Entry
I653_01455        CDS       T02520                                 

Definition
(GenBank) putative transporter
  KO
K08369  
MFS transporter, putative metabolite:H+ symporter
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Brite
Transporters [BR:bsy02000]
 Major Facilitator Superfamily (MFS)
  Unknown transporters
   Others
    I653_01455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
308627..309829
Genome map
AA seq 400 aa AA seqDB search
MGKQQPISQRKLLGVAGLGWLFDAMDVGILSFIIAALHVEWNLSPEEMKWIGSVNSIGMA
AGAFLFGLLADRIGRKKVFIITLLCFSIGSGISAFVTSLSAFLILRFVIGMGLGGELPVA
STLVSEAVVPEKRGRVIVLLESFWAVGWLAAALISYFVIPSFGWQAALLLTALTAFYALY
LRTSLPDSPKYESLSAKKRSVWENVKSVWARQYIRPTVMLSIVWFCVVFSYYGMFLWLPS
VMLLKGFSMIQSFEYVLLMTLAQLPGYFSAAWLIEKAGRKWILVIYLIGTAGSAYFFGTA
DSLSLLLTAGMLLSFFNLGAWGVLYAYTPEQYPTAIRATGSGTTAAFGRIGGIFGPLLVG
TLAARHISFSVIFSIFCIAILLAVACILIMGKETKQTELE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaacaacagcctatatcccagcgtaaactgctgggcgtcgccggtttggggtgg
ctgtttgatgcaatggatgtcggaatattatcgtttattatcgccgcgctccatgtagag
tggaatctgtcgcccgaggaaatgaaatggatcggaagcgtcaattccatcggcatggct
gcgggtgcgtttttgtttggtttgcttgctgatcgaatcggccgcaaaaaagtgttcatc
atcacccttttatgcttttccatcggaagcggcatttccgcttttgtgacgagcttatcg
gcatttctaatccttcgtttcgtgattggtatgggacttggcggcgagcttccagtcgct
tcaacactcgtttcggaagcggttgtgcctgaaaagcgaggcagagtgattgtgcttttg
gaaagcttttgggccgtgggctggctcgcagcggccttgatttcttactttgtgatacca
agcttcggctggcaggctgcccttctgttaactgcgctgactgctttttatgcgctgtac
ctgcggacgagtctgcctgattcgccgaaatatgaatcgctttctgccaaaaagaggtcg
gtgtgggagaatgtaaaaagcgtctgggcaagacagtatatacggccgaccgtaatgctg
tcgatcgtttggttctgtgtggtgttttcttattacggcatgttcttatggctgccgagt
gtcatgctgctgaaaggcttcagcatgattcaaagctttgaatatgtcctgctgatgacg
cttgctcagctaccgggctatttctctgccgcctggctgattgaaaaagcaggccggaag
tggatactcgtcatttacttgattggtacagcaggaagcgcctatttcttcggaacggcg
gattccttaagtcttctgcttacggctggaatgctgttatcgtttttcaatctcggtgcg
tggggcgtgctgtatgcttataccccggagcaatacccgactgcgattcgagcaacaggt
tcaggaacgacagcagcgtttggaagaatcggcggcatcttcgggcctttgctcgtcgga
accctggcagcccgtcatatttcgttttcggtcatcttttcaatcttttgcattgcaatc
ttactcgcggttgcttgtattttgattatggggaaagaaacgaaacaaactgagctggaa
tag

DBGET integrated database retrieval system