KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01495Help
Entry
I653_01495        CDS       T02520                                 

Definition
(GenBank) integral inner membrane protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
317824..318315
Genome map
AA seq 163 aa AA seqDB search
MNNLRNRLSGVNGKNKRVKEKEQKIWSEIGMIAGAFALLDVIIRGIMFEFPFKEWAASLV
FLFIIILYYCIRAAASGMLMPRIDTKEELQKRVKQQRIESIAVAFAVVVLTMYDRGIPHT
FFAWLKMILLFIVCGGVLFLLRYVIVKLAYRRAVKEEIKKKSS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaataatctgcgtaatagactttcaggcgtgaatgggaaaaataagagagtaaaagaa
aaagaacaaaaaatctggtcggagattgggatgatagcgggagcatttgcgctgcttgat
gtgatcatccgcggcattatgtttgaatttccgtttaaagaatgggctgcaagccttgtg
tttttgttcatcattatcttatattactgcatcagggctgcggcatccggaatgctcatg
ccgagaatagacaccaaagaagaactgcaaaaacgggtgaagcagcagcgaatagaatca
attgcggtcgcctttgcggtagtggtgcttacgatgtacgacagggggattccccataca
ttcttcgcttggctgaaaatgattcttctttttatcgtctgcggcggcgttctgtttctg
cttcggtatgtgattgtgaagctggcttacagaagagcggtaaaagaagaaataaaaaag
aaatcatcttga

DBGET integrated database retrieval system