KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01505Help
Entry
I653_01505        CDS       T02520                                 

Gene name
ldh
Definition
(GenBank) L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00010  Glycolysis / Gluconeogenesis
bsy00270  Cysteine and methionine metabolism
bsy00620  Pyruvate metabolism
bsy00640  Propanoate metabolism
bsy01100  Metabolic pathways
bsy01110  Biosynthesis of secondary metabolites
bsy01120  Microbial metabolism in diverse environments
bsy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I653_01505 (ldh)
   00620 Pyruvate metabolism
    I653_01505 (ldh)
   00640 Propanoate metabolism
    I653_01505 (ldh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    I653_01505 (ldh)
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     I653_01505 (ldh)
Exosome [BR:bsy04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   I653_01505 (ldh)
  Exosomal proteins of breast milk
   I653_01505 (ldh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C UDPG_MGDP_dh_N 3HCDH_N Sacchrp_dh_NADP F420_oxidored GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AGI27571
Structure
PDB: 

Jmol
Position
320731..321693
Genome map
AA seq 320 aa AA seqDB search
MNKQVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAMGDVMDLNHGKAFAPQP
VKTSYGTYEDCKDADIVCICAGANQKPGETRLELVEKNLKIFKGIVSEVMASGFDGIFLI
ATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRFMLSEYFGAAPQNVHAHIIGEHGD
TELPVWSRANVGGVPVSELVEKNDAYKQEELDQIVDDVKNAAYHIIEKKGATYYGVAMSL
ARITKAILHNENSILTVSTYVDGQYGADDVYIGVPAVVNRGGIAGITELNLNEKEKEQFL
HSAGVLKNILKPHFAEQKVN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacaagtaaataaagtagctttaatcggagcgggttttgttggaagcagttat
gcatttgcgttaattaaccaagggatcacagatgagcttgtggtcattgatgtaaataaa
gaaaaagcaatgggcgatgtgatggatttaaaccacggaaaggcgtttgcgccacaaccg
gtcaaaacatcttacggaacatatgaagactgcaaggatgctgatattgtctgcatttgc
gccggagcaaaccaaaaacctggtgagacacgccttgaattagtagaaaagaacttgaag
attttcaaaggcatcgtcagtgaagtcatggcgagcggatttgacggcattttcttaatc
gcgacaaatccggttgatatcctgacttacgctacatggaaattcagcggcctgccaaaa
gagcgggtgatcggaagtggcacaacacttgattctgcgagattccgtttcatgctgagc
gaatactttggcgcagcgcctcaaaacgtgcacgcgcatattatcggagagcacggcgac
acagagcttcctgtttggagccgcgcgaatgtcggcggtgtgccggtcagtgaactcgtt
gagaaaaacgatgcgtacaaacaagaggagctggaccaaattgtagatgatgtgaaaaac
gcagcttaccatatcattgagaaaaaaggcgcgacttattatggagttgcgatgagtctt
gctcgcattacaaaagccattcttcataatgaaaacagcatattaactgtcagcacatat
gtggacgggcaatacggtgcagatgacgtgtacatcggtgtgccggctgtcgtgaaccgc
ggagggatcgcaggtatcactgagctgaacttaaatgagaaagaaaaagaacagtttctt
cacagcgccggtgtccttaaaaacattttaaaacctcattttgcagaacaaaaagtcaac
taa

DBGET integrated database retrieval system