KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01505Help
Entry
I653_01505        CDS       T02520                                 

Gene name
ldh
Definition
(GenBank) L-lactate dehydrogenase
  KO
K00016  
L-lactate dehydrogenase [EC:1.1.1.27]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Glycolysis / Gluconeogenesis
Cysteine and methionine metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I653_01505 (ldh)
   00620 Pyruvate metabolism
    I653_01505 (ldh)
   00640 Propanoate metabolism
    I653_01505 (ldh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    I653_01505 (ldh)
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     I653_01505 (ldh)
Exosome [BR:bsy04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   I653_01505 (ldh)
  Exosomal proteins of breast milk
   I653_01505 (ldh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
320731..321693
Genome map
AA seq 320 aa AA seqDB search
MNKQVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAMGDVMDLNHGKAFAPQP
VKTSYGTYEDCKDADIVCICAGANQKPGETRLELVEKNLKIFKGIVSEVMASGFDGIFLI
ATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRFMLSEYFGAAPQNVHAHIIGEHGD
TELPVWSRANVGGVPVSELVEKNDAYKQEELDQIVDDVKNAAYHIIEKKGATYYGVAMSL
ARITKAILHNENSILTVSTYVDGQYGADDVYIGVPAVVNRGGIAGITELNLNEKEKEQFL
HSAGVLKNILKPHFAEQKVN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacaagtaaataaagtagctttaatcggagcgggttttgttggaagcagttat
gcatttgcgttaattaaccaagggatcacagatgagcttgtggtcattgatgtaaataaa
gaaaaagcaatgggcgatgtgatggatttaaaccacggaaaggcgtttgcgccacaaccg
gtcaaaacatcttacggaacatatgaagactgcaaggatgctgatattgtctgcatttgc
gccggagcaaaccaaaaacctggtgagacacgccttgaattagtagaaaagaacttgaag
attttcaaaggcatcgtcagtgaagtcatggcgagcggatttgacggcattttcttaatc
gcgacaaatccggttgatatcctgacttacgctacatggaaattcagcggcctgccaaaa
gagcgggtgatcggaagtggcacaacacttgattctgcgagattccgtttcatgctgagc
gaatactttggcgcagcgcctcaaaacgtgcacgcgcatattatcggagagcacggcgac
acagagcttcctgtttggagccgcgcgaatgtcggcggtgtgccggtcagtgaactcgtt
gagaaaaacgatgcgtacaaacaagaggagctggaccaaattgtagatgatgtgaaaaac
gcagcttaccatatcattgagaaaaaaggcgcgacttattatggagttgcgatgagtctt
gctcgcattacaaaagccattcttcataatgaaaacagcatattaactgtcagcacatat
gtggacgggcaatacggtgcagatgacgtgtacatcggtgtgccggctgtcgtgaaccgc
ggagggatcgcaggtatcactgagctgaacttaaatgagaaagaaaaagaacagtttctt
cacagcgccggtgtccttaaaaacattttaaaacctcattttgcagaacaaaaagtcaac
taa

DBGET integrated database retrieval system