KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01525Help
Entry
I653_01525        CDS       T02520                                 

Definition
(GenBank) putative aminoacid export permease
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
325584..326213
Genome map
AA seq 209 aa AA seqDB search
MNIFLSYIVLGLSLSAPVGPVNAAQIDKGIKNGFWHAWIFGLGAMTADGLYMLFIYFGLS
QFLTAPFVKTFLWLFGFFVLTYTGIETLKNVREPMDVRSSRGKPSYRKTFASGFLISLSN
PLSILFWLGIYGSILAKTAEAYNMNQLLIYSSGIMIGILIWDFCMAITASTFRNLLHEKL
LRGLTGIAGVSLLVFGFYFGYQGIKQLLG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatttttttgagctatattgtgctggggctgtccttgtctgcgcctgtggggcca
gtgaatgcggcgcaaatagacaaaggaattaaaaacggtttttggcatgcatggattttc
ggtttaggcgccatgacagcggatgggctgtacatgctttttatctatttcgggctgtca
cagttcttgactgctccatttgtgaaaacgtttttgtggctcttcggtttttttgtcctg
acctataccggaattgaaacgctgaaaaacgtcagagaaccgatggatgtgcgaagctcg
cgggggaaaccgtcatacaggaaaacattcgcatcgggttttctcatttcattgtcaaac
ccattgagcatccttttttggcttggaatttacggaagcattcttgcgaaaacagcagag
gcctacaatatgaatcagcttctaatctatagctccggcatcatgatcggcattttaatc
tgggatttctgcatggctatcacagccagtacgttcagaaacctgcttcatgaaaagcta
ttgagaggattgaccggaatcgccggtgtatccctccttgtgtttggcttttactttggt
tatcagggcatcaaacagttattgggctga

DBGET integrated database retrieval system