KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01530Help
Entry
I653_01530        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
  KO
K09190  
uncharacterized protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
326283..327044
Genome map
AA seq 253 aa AA seqDB search
MVNGIYTKSFLERSQDELPEWQRIAFELLAETLGDEADMFPCIPGRQAFLTDQLRIAFAG
DPRENRTAEDLAPLLAEYGKISRDTGKYASFVVLFDTPEDLAEHYSIEAYEELFWRFLNR
LSHQDEKEWPEDIPADPEHYKWEFCFDGEPYFLLCATPAHEARKSRSFPFFMITFQPRWV
FEDLNGSTAFGRNMSRLIRSRLEAYDQAPIHPQLGWYGGKDNREWKQYFLRDDEKQVSKC
PFSYLKNMFNKMK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatgggatttacaccaaaagttttctggaacgtagtcaagatgagctcccggaa
tggcaaagaatcgcttttgagctgctggcagaaacgctgggggacgaagcggatatgttt
ccgtgcattcccggacgccaggcgtttctgactgatcagcttcggattgcttttgcagga
gatccgcgggaaaaccgtacagcggaggacctggctccgttgcttgcggagtacggcaag
atatcgcgggacacgggaaaatacgcatccttcgttgtgttgtttgatacgccggaagat
ttggctgagcactattcgattgaagcgtatgaagagctgttttggcgctttttaaataga
ctgagtcatcaagacgaaaaagaatggccggaagacattccggccgatcccgagcattat
aaatgggagttttgttttgacggcgagccgtactttcttctctgcgctacaccggcgcac
gaggcgagaaaaagccgaagctttcctttttttatgataacgtttcagccaaggtgggtg
tttgaggacctaaatggatcaactgcatttggccgtaacatgagcaggctgatccgatct
cgtttagaggcctatgatcaggctccaattcacccgcaattaggctggtacggaggaaag
gataatcgtgaatggaagcagtatttcctccgtgacgacgaaaaacaggtatcgaagtgc
ccgttttcttatttaaagaatatgttcaacaaaatgaaataa

DBGET integrated database retrieval system