KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01560Help
Entry
I653_01560        CDS       T02520                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsy01100  Metabolic pathways
bsy01110  Biosynthesis of secondary metabolites
bsy01130  Biosynthesis of antibiotics
bsy01230  Biosynthesis of amino acids
Module
bsy_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    I653_01560 (aroK)
Enzymes [BR:bsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     I653_01560 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA AAA_18 AAA_14 AAA_16 AAA_22 GCR1_C AAA_33 TsaE Zeta_toxin PX
Motif
Other DBs
NCBI-ProteinID: AGI27582
Position
330981..331541
Genome map
AA seq 186 aa AA seqDB search
MNAKRAIPVRERNIVLIGFMGVGKTTIGQLVAKKLYRDFIDIDQEIEKDFNMSIPEIFEK
KGEDFFRKTEKEYILDICHHKRFKIVSLGGGSFKQEEIRNCCLENCLVLHLDLSWENWKQ
RADLLIESRPVLHNRSMDEMEQLFNERKVIYDKHNSKVATDNLSPEEVADYIVETLKIGW
DLYQPM
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctaaacgagccatcccagtaagagaaagaaatatcgtcctgattggattcatg
ggtgtaggaaaaacgacaatcggccaattggtcgctaaaaaattatatagagattttatt
gatattgaccaagagatcgaaaaggatttcaatatgtcaattcctgagatatttgagaaa
aagggagaagactttttccggaaaacggagaaggaatatattttagacatctgccatcat
aaacgattcaaaatcgtatctctgggcgggggatcttttaaacaagaagaaatcagaaat
tgctgtctggaaaactgtctcgtgcttcatcttgacctgtcatgggagaattggaagcag
cgcgcggatttattgatcgaaagccgccctgtactgcataaccgttcaatggatgaaatg
gaacagctgtttaacgaaagaaaagtcatttatgacaagcacaattcaaaagtggcaaca
gacaacctttccccggaagaggttgccgattacattgttgagacattaaaaattggctgg
gatctttatcagccgatgtaa

DBGET integrated database retrieval system