KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01565Help
Entry
I653_01565        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(331569..332330)
Genome map
AA seq 253 aa AA seqDB search
MTNETPFSKNAEMYRDEKVFAEGEDLGLMIKTAECRAEHRVLDIGAGAGHTALAFSPYVQ
ECIGVDATKEMVEVASSFAQEKGAENVRFQQGTAESLPFPDDSFDIITCRYAAHHFSDVR
KAVSEVARVLKQDGRFLLVDHYAPEDPILDEFVNQLNRLRDPSHVRESSLSEWQAMFSAN
QLAYQDIQKWNLPIQYDSWIKRGGTPADREKQIIAHLNHTSDEARDTFCITLNRNGQPVS
FCLKAILIQGIKR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaaacaccgttttctaaaaacgccgagatgtatcgggatgaaaaggtattt
gccgagggggaagatttggggttgatgatcaaaacagcggaatgccgggcagagcatcgg
gtgctggatatcggagcgggcgccggccatacggccctggcattttctccttatgtacag
gagtgcatcggtgttgatgcaacgaaagagatggtagaggttgcgtcctccttcgcgcaa
gaaaaaggagctgaaaacgtacgctttcagcaaggaacggcagagtcactccccttcccc
gacgattcatttgatatcatcacctgccgatacgcagcccaccatttttcagatgtccgc
aaagctgtcagcgaggttgcacgcgtactgaaacaggacggacgttttctcttagttgat
cattacgcgcctgaagatcccattcttgatgagtttgtcaatcagttgaaccggcttcga
gacccttcccatgttcgagaaagctcattatcagaatggcaggcgatgttcagcgccaat
caactggcttatcaagacatccaaaagtggaacttgccgattcaatacgatagctggatc
aaacgaggcggaacccccgctgaccgggaaaaacaaatcattgcccacttgaaccacaca
tcagacgaagcacgcgacacgttctgtattacattaaaccgaaacggacagcccgtctcc
ttttgtttaaaagcgattttgatacaagggataaaacgataa

DBGET integrated database retrieval system