KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01575Help
Entry
I653_01575        CDS       T02520                                 

Definition
(GenBank) S-deacylase
  KO
K01060  
cephalosporin-C deacetylase [EC:3.1.1.41]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Penicillin and cephalosporin biosynthesis
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    I653_01575
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.41  cephalosporin-C deacetylase
     I653_01575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
333493..334449
Genome map
AA seq 318 aa AA seqDB search
MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLT
YKSFENARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYAAFGMLVRGQ
QSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGG
SQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQ
AMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETEKELKVYRYFGHEY
IPAFQTEKLAFFKQHLKG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcaactattcgatctgccgctcgaccaattgcaaacatataagcctgaaaaaacagca
ccgaaagatttttctgagttttggaaattgtctttggaggaacttgcaaaagtccaagca
gaacctgatttacagccggttgactatcctgctgacggagtaaaagtgtaccgtctcaca
tataaaagcttcgaaaacgcccgcattaccggatggtacgcggtgcctgacaaggaaggc
ccgcatccggcgatcgtgaaatatcatggctacaatgcaagctatgatggtgagattcat
gaaatggtaaactgggcactccatggatacgccgcattcggcatgcttgtccgcggccag
cagagcagcgaggatacgagtatttcaccgcacggtcacgctttgggctggatgacgaaa
ggaattcttgataaagatacatactattaccgcggtgtttatttggacgccgtccgcgcg
cttgaggtcatcagcagcttcgacgaggttgacgaaacaaggatcggtgtgacaggagga
agccaaggcggaggtttaaccattgccgcagcagcgctgtcagacattccaaaagccgcg
gttgccgattatccttatttaagcaactttgaacgggccattgatgtggcgcttgaacag
ccgtaccttgaaatcaattccttcttcagaagaaatggcagcccggaaacagaagtgcag
gcgatgaagacactttcatatttcgatattatgaatctcgctgaccgagtgaaggtgcct
gtcctgatgtcaatcggcctgattgacaaggtcacgccaccgtccaccgtgtttgccgcc
tacaatcatttggaaacagagaaagagctgaaggtgtaccgctacttcggacatgagtat
atccctgcttttcaaacggaaaaacttgctttctttaagcagcatcttaaaggctga

DBGET integrated database retrieval system