KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01580Help
Entry
I653_01580        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
  KO
K07074  
uncharacterized protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
334533..335315
Genome map
AA seq 260 aa AA seqDB search
MKQRIIDELKRIEQSYGVKIVYAVESGSRAWGFPSQDSDYDVRFIYVPKKEWYFSIEQER
DVIEEPIHDLLDISGWELRKTLRLFKKSNPPLLEWLSSDIVYYEAFTTAEQLRKLRKEAF
KPEASVYHYINMARRNVKDYLQGQEVKIKKYFYVLRPILACQWIEKHGTIPPMDFTVLMN
ELIAEPELKAEMETLLERKRRGEELDLEARIDVIHQFIETEIERIMEAAKELKAEKKDMT
PELNRLLLNTVEEVWKDGGS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagaatcattgatgaattaaaacggatcgagcagtcatacggagtcaaaatc
gtgtatgccgtcgagtcaggaagccgcgcatggggatttccctcgcaggatagtgattac
gacgtccgctttatttatgtgccgaaaaaggagtggtatttttcaattgagcaggagcgg
gatgtgattgaggaaccgattcacgatttactggatatcagcggctgggagctgagaaag
acgctgcgcctcttcaaaaaatcaaacccgccgctccttgaatggctgtcctcagacatt
gtgtattacgaagcatttacgaccgcagagcagttaagaaaactgcggaaggaggcattt
aagcctgaagcaagcgtgtatcactatatcaatatggcgagaaggaacgtcaaggattat
ctacaaggacaagaggtcaaaattaaaaagtacttctacgttcttcggcctattttggcc
tgccaatggattgaaaagcacggaaccattccgccaatggactttactgttttgatgaat
gaacttattgctgaacccgagctgaaggctgaaatggaaactttgcttgaacggaaaaga
agaggagaagagcttgacctcgaagcaagaatcgatgttattcaccaattcattgaaacg
gaaatcgaaagaatcatggaagcggcaaaagaactgaaggcagagaaaaaagatatgaca
cctgagttgaaccgtttgcttttgaatacggttgaagaagtgtggaaggatggaggaagc
tga

DBGET integrated database retrieval system