KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01585Help
Entry
I653_01585        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
  KO
K00318  
proline dehydrogenase [EC:1.5.-.-]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    I653_01585
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.-  Acting on the CH-NH group of donors
    1.5.-.-  
     I653_01585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
335499..336416
Genome map
AA seq 305 aa AA seqDB search
MEVITRDFFLFLSKSGFLNKMARNWGSRVAAGKIIGGNDFNSSIPTIRQLNSQGLSVTVD
HLGEFVNSAEVARERTEECIQTIATIADQELNSHVSLKMTSLGLDIDMDLVYENMTKILQ
TAEKHKIMVTIDMEDEVRCQKTLDIFKDFRKKYEHVSTVLQAYLYRTEKDIDDLDSLNPF
LRLVKGAYKESEKVAFPEKSDVDENYKKIIRKQLLNGHYTAIATHDDKMIDFTKQLAKEH
GIAHDKFEFQMLYGMRSQTQLSLVKEGYNMRFSLPYGEDWYGYFMRRLAERPSNIAFAFK
GMTKK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttggaagtgatcacaagagattttttcttatttttatccaaaagcggctttctcaataaa
atggcgaggaactggggaagccgggtagcagcgggtaaaattatcggcgggaatgacttt
aacagttcaatcccgaccattcgacagcttaacagccaaggcctgtcagttactgtcgat
catttaggcgagttcgtgaacagcgccgaggtcgcacgggagcgtacggaagagtgcatt
caaaccattgcgaccatcgcggatcaggagctgaactcacacgtttctttaaaaatgacg
tctttaggtttggatatagatatggatttggtgtatgaaaatatgacaaaaatccttcag
acggccgagaaacataaaatcatggtcaccattgacatggaggacgaagtcagatgccag
aaaacgcttgatattttcaaagatttcagaaagaaatacgagcatgtgagcacagtgctg
caagcctatctgtaccggacggaaaaagacattgacgatttggattctttaaacccgttc
cttcgccttgtaaaaggagcttataaagaatcagaaaaagtagctttcccggagaaaagc
gatgtcgacgaaaattacaaaaaaatcatccgaaagcagctcttaaacggtcactataca
gcgattgccacacatgacgacaaaatgatcgactttacaaagcagcttgccaaggaacat
ggcattgcccatgacaagtttgaatttcagatgctgtacggcatgcggtcgcaaacccag
ctcagcctcgtaaaagaaggttataacatgagattctccctgccatacggcgaggattgg
tacggctactttatgagacgccttgcagaacgtccgtcaaacattgcatttgctttcaaa
ggaatgacaaagaagtaa

DBGET integrated database retrieval system