KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01595Help
Entry
I653_01595        CDS       T02520                                 

Definition
(GenBank) putative proline/ornithine permease
  KO
K11928  
sodium/proline symporter
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Brite
Transporters [BR:bsy02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   I653_01595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
338176..339525
Genome map
AA seq 449 aa AA seqDB search
MGPAVTALSAGAADMSGWLLMGLPGAMFSTGLSGVWIVFGLCLGAWANWLYVAPRLRTYT
EKAGNSITIPGFLENRFGDQTKLLRLFSGIVILVFFTFYVSSGMVSGGVLFNSILGMDYH
TGLWIVTGVVVAYTLFGGFLAVSWTDFVQGIIMFAALILVPIVTFFHTGGAGDTVAEIRS
VDPDMFNIFKGTSVLGIISLFAWGLGYFGQPHIIVRFMAITSVKEIKRARRIGMGWMILS
AVGAVLTGLGGIAYYHQRGMTLKDPETIFIQLGNILFHPIITGFLISAILAAIMSTISSQ
LLVTSSSLVEDLYKSMFRRSASDKELVFLGRLAVLAVSIVALVLAWEKNNTILGLVSYAW
AGFGASFGPVVLLSLFWKRMTKWGALAGMIVGAATVIIWANAGLSDFLYEMIPGFAASLL
SVFFVSILTQAPSQAVTDQFNDYQDTMSQ
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
ttgggtccggcagtaaccgctctcagtgccggcgctgccgatatgagcggctggctgcta
atggggctcccgggcgccatgttttcaacaggtctgagcggagtttggattgtgttcgga
ctttgccttggagcatgggcgaactggctctacgttgcgccgcggctgagaacctatact
gaaaaagcggggaattcaattacaattcccggattcctggagaatcgcttcggagatcaa
acaaagcttctcagactgttttcgggaattgtcattttagtctttttcacgttttatgta
tcgtccggaatggtgtccggcggcgtcttattcaacagcatcttggggatggattatcac
accggcctgtggattgtgacgggtgttgttgtggcatataccctgtttggcggctttttg
gcagtcagctggacagattttgttcaggggatcattatgtttgccgcactcattcttgtg
ccgatcgttacgtttttccacacaggaggagcaggtgatacagttgctgaaatccgctct
gtagaccctgatatgtttaatattttcaaaggaacgagcgtccttggcattatttctttg
tttgcctgggggctgggatactttggccagccgcatattattgtgcgttttatggcgatc
acgtctgtcaaagagatcaaaagagcgcgcagaatcgggatgggctggatgattttgtct
gcagtaggcgcagtgctgaccggtttgggcggaatcgcttattaccatcagcggggcatg
acactgaaggaccctgagacgatttttattcagttagggaatatcttgttccatccgatt
atcacgggttttctgatttcagcgattttggctgcgattatgagtaccatttcttctcag
ctgcttgtgacatcaagctctctggtagaagatttgtataagtcgatgttcagacgctca
gcttcagataaagaactggtgtttttaggccgactggctgttctggctgtttcaattgtc
gcgttggttctggcttgggagaaaaataacaccatccttggattggtcagctacgcgtgg
gcgggcttcggtgcatcattcgggccggttgtactgctcagtctgttttggaaacgaatg
accaaatggggggcactcgccggcatgattgtgggagcagcgactgtaatcatttgggcg
aatgccggtctttcggactttctgtatgaaatgatacctggttttgctgcgagtctatta
tctgtcttttttgtcagcatattgacgcaggctccgtcacaagctgtcacagaccagttc
aacgactaccaagatacaatgtcacaataa

DBGET integrated database retrieval system