KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01605Help
Entry
I653_01605        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
  KO
K08986  
putative membrane protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(340950..341807)
Genome map
AA seq 285 aa AA seqDB search
MFRLLVLMGFTFFFYHLHASGNLTKYINMKYAYLSFIAIFLLAILTVVQAYLFIKSPEKG
GHHHDHDCGCGHDHEHDHEQNKPFYQRYLIYLVFIFPLVSGIFFPIATLDSSIVKTKGFS
FKAMESGDHYSQTQYLRPDASLYYAQDSYDKQMKQLFNKYSSKKEISLTDDDFLKGMETI
YNYPGEFLGRTIEFHGFAYKGNAINKNQLFVLRFGIIHCIADSGVYGMLVEFPKDMDIKD
DEWIHIKGTLASEYYQPFKSTLPVVKVTDWNTIKKPDDPYVYRGF
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtctattggtgctgatgggatttacgtttttcttttatcatctgcatgcctca
ggaaatctaacaaaatatatcaatatgaaatatgcctatctttcctttattgcgatcttc
ctgctggccattctgacagtcgttcaagcatatctatttatcaagtcgcctgaaaaaggc
gggcatcaccatgaccatgattgcgggtgcggccatgatcacgagcatgaccatgaacaa
aacaagccattttatcagcgttatttgatttatcttgtttttattttccctttagtgtca
ggcatcttcttcccgattgcgacgcttgactcatccattgttaaaacaaaagggttctcg
tttaaggcgatggagagcggagatcactactcccaaacacagtatttgcgtcctgatgcc
agcctgtattacgcgcaagacagctatgacaaacaaatgaaacagctgtttaataagtat
tccagcaaaaaagagatttctctgaccgatgacgatttcctaaaaggaatggaaaccatc
tataactatccgggtgaatttctcggacggacgattgaattccatggatttgcttacaaa
ggaaacgcaattaacaaaaatcagctgttcgtattaaggtttggcatcattcactgtatc
gctgattccggcgtgtacgggatgcttgtggaatttccgaaggacatggacatcaaggat
gatgaatggattcacattaagggcactctggcctcagaatattaccagccatttaagtca
actctccctgtcgtcaaagtaactgactggaataccataaaaaaacctgatgatccgtat
gtttacagaggattttaa

DBGET integrated database retrieval system