KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01630Help
Entry
I653_01630        CDS       T02520                                 

Definition
(GenBank) assimilatory nitrite reductase subunit
  KO
K00363  
nitrite reductase (NADH) small subunit [EC:1.7.1.15]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    I653_01630
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     I653_01630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(346370..346690)
Genome map
AA seq 106 aa AA seqDB search
MVNKDVTKVCIGKIEELPEQLGKTVYIEDKELAVFKLSDGSIRAIENRCPHKGGVLAEGI
VSGEYVFCPMHDWKISLEDGIVQEPDHGCVKTYETLIEGEHVYLVY
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaaagacgtaacaaaagtatgtatcggaaaaattgaagaattgcctgaacaa
ttaggcaaaacagtgtatattgaagataaggagctcgcggttttcaagctttcagacgga
agcatccgcgccatcgaaaaccgctgtccgcataagggcggcgtcctggcagaaggcatc
gtcagcggtgaatatgttttctgcccgatgcacgactggaaaatttccttagaagacgga
atcgtccaagaacctgaccacggatgcgtcaaaacatatgaaacgctgatcgaaggagaa
catgtttatctcgtatattga

DBGET integrated database retrieval system