KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01645Help
Entry
I653_01645        CDS       T02520                                 

Definition
(GenBank) assimilatory nitrate reductase
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00910  Nitrogen metabolism
bsy01120  Microbial metabolism in diverse environments
Module
bsy_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    I653_01645
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     I653_01645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD Pyr_redox Pyr_redox_3 NIR_SIR_ferr NIR_SIR AlaDh_PNT_C GIDA 3HCDH_N Glyco_trans_4_5
Motif
Other DBs
NCBI-ProteinID: AGI27599
Position
complement(351389..353713)
Genome map
AA seq 774 aa AA seqDB search
MKKQRLVLAGNGMAGIRCIEEVLKLNRHMFEIVIFGSEPHPNYNRILLSSVLQGEASLDD
ITLNSKDWYDKHGITLYTGETVIQIDTDQQQVITDRKRILSYDKFIVATGSSPHILPIPG
ADKKGVYGFRTIEDCQALMKMTQHFQKAAVIGAGLLGLEAAVGLQHLGMDVSVIHHSAGI
MQKQLDQTAARLLQTELEQKGLTFLLEKDTVSISGATKADRIHFKDGSSLKADLIVMAAG
VRPNIELAVSAGIKVNRGIIVNDFMQTSEPNIYAVGECAEHNGTVYGLVAPLYEQGKALA
SHICGVPCEEYQGSAPSAALKIAGIDVWSAGKIQEDERTTSIKIYDEQAGVYKKALFVDD
KLAGVILFGDTRDKQRLLDSLLKQRDISIVKKQIIEPETSGPLFESMPSSETICQCNTVT
KGAIEDAVHTNSLTTVEEVKHCTKATGSCGGCKPLVEDLLRHMTNSEYTKPAGTPSFCSC
TDFTEDDIIAELQRRPFTNPAEVMNQLDWKTKKGCSTCVPAIQYYLEMLYPGFVQPEPAT
EEACILIPQMYGGRTNAEQLRTIANIIEAYSIPDVSITHGQRLKLSGIKPADLPNIKKDL
KMPVYTNEHRHALQSIKACTCGQNRSIQQLAAQIERQLEMLPLPAPISISLSCETDCTHA
ALQDVGAIRTQAGWDIYIGGVRGTHARSGALFCVTENEDSTAGMIKGLIQYYRETAHYLE
AVHQWIDRLGIVHIREVLFEEDLRAQLLESLQTDLSLIQNPTVETAHIRKDEAF
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacaaagattggtgttagcgggaaacggcatggccggaatccgctgtattgaa
gaagtattaaagctgaatcgccacatgtttgagattgtcattttcggaagcgagccgcat
cccaattacaatcgcattctcttatcctctgtattgcagggtgaagcgtcactcgatgac
attacactgaacagcaaggattggtacgacaagcacgggatcacgctttacacaggcgaa
acggttattcaaattgatacagatcagcagcaggtcataacggatcgcaagcgcatcctg
tcttatgacaaattcattgtggcaacaggttcctcccctcatattctccctatccccggg
gcagacaaaaaaggtgtctatggatttcggacaatagaagactgccaagcgctgatgaag
atgactcagcactttcaaaaggctgcggtaatcggagccggcttattaggactggaagct
gcagtcggcttacagcatctcggtatggatgtcagcgtcattcaccactccgccggcatt
atgcaaaaacagctcgatcaaacagcggcgcggctgctgcaaacagagctggaacaaaaa
ggcctaacctttcttttggagaaagacaccgtctccatttccggcgccaccaaggcagac
cgaatccattttaaagatggctcttcattaaaagcagacttgattgtgatggcggccggc
gtcagaccgaatattgaattagctgtatccgctggaatcaaagtgaaccgcgggatcatc
gtgaatgacttcatgcagacaagcgaaccgaatatctacgccgtcggtgaatgcgccgaa
cataacggaacggtgtacggattggtggcaccgctttatgagcagggaaaagctctcgcc
agtcatatttgcggcgttccatgtgaggaatatcaaggctcagcaccatctgcggcttta
aaaatagctggaatcgatgtgtggtcagcaggaaagatccaagaggatgaacgcacgacg
agcatcaaaatctacgacgaacaagcaggcgtttataaaaaagcgctttttgtagatgac
aaactggccggcgttattttattcggagacacccgtgacaagcagcggcttctcgacagc
ctgcttaaacaacgagacatctccattgtcaaaaagcagatcatcgaaccagagacaagc
ggccctttatttgaatccatgccttccagtgaaacgatttgccaatgcaacacagtgacg
aaaggcgcgattgaagacgcggtgcacacgaatagcttaacaactgttgaggaagtcaag
cactgcaccaaagccactgggtcctgcggaggatgcaaaccgctcgttgaagaccttttg
aggcacatgaccaacagcgaatatacgaagcccgccggcacaccttcgttttgcagctgt
actgattttacagaagacgacatcatcgctgagcttcagcgcaggccattcactaatccg
gcagaagtgatgaaccagcttgactggaaaacaaaaaaaggatgcagtacttgtgttcct
gcgattcaatactatctggaaatgctgtaccccgggtttgtccagccggagccagccact
gaagaggcatgcatcctgattccgcaaatgtacggcggacggacaaacgcggagcagcta
agaaccatcgccaacatcattgaggcatacagcattcccgacgtatccatcactcacggc
caaaggctgaagctttccgggatcaagcctgcggatctcccgaatataaaaaaagacctg
aaaatgcccgtttacaccaatgaacaccgacacgcgctgcaaagcatcaaagcatgtaca
tgcgggcaaaatcgatcgattcagcagctggcagcccaaatcgaaagacaacttgagatg
cttcccttacccgctcccatttctatcagcttatcatgtgaaacagactgcacccatgcc
gccctgcaagatgtcggcgcaattcggacacaagctggctgggacatttacatcggcggc
gtccggggaactcatgcccgttcaggagctctgttttgcgtgactgagaatgaagacagc
actgccggcatgatcaaaggactgatccagtattatcgggaaacggctcattacttagaa
gctgttcatcagtggatagaccgtctcgggatcgttcatatcagagaagtgctattcgaa
gaagacctaagggcacagctgctggaaagcctccaaacagatctgtcactgattcaaaac
ccgactgtagagacggcgcatataagaaaggatgaggcattttga

DBGET integrated database retrieval system