KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01655Help
Entry
I653_01655        CDS       T02520                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K09007  
GTP cyclohydrolase IB [EC:3.5.4.16]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    I653_01655
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     I653_01655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
355215..356129
Genome map
AA seq 304 aa AA seqDB search
MNQHTLLPKKTERLQYFGSVSPIKGEKPVEKEKMKDLQNIRKDYFFDIQHVGVANVSHPV
TITSAMMPAEQTTAANFTMTCNLPRNQKGTNMSRLTELLQVYHQNGWVLSFSSLQQFAKE
LAENMDISSATVEVRFPWFFERKSPKLEKAGLMHADIFMSVTYRKDQPFKQRAGISAKVT
TLCPCSKEISEYSAHNQRGTVSIWADIHPAASLPSDVKADLLHAAESNASARLHPVLKRP
DEKAVTETAYENPRFVEDLARLIAADLFELEWVSAFEIECRNEESIHLHDAYAKLCFSKE
VDKI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacatacgctgctcccgaaaaaaacggagcgtcttcaatactttggatcggtc
agtccgatcaaaggcgagaaaccagtggaaaaagagaaaatgaaggacctgcaaaatatc
aggaaggattatttttttgacattcagcatgtaggtgtcgctaatgtgtcccatccagtc
acaatcacttctgccatgatgcctgccgagcaaacaacggctgcgaactttacaatgact
tgtaatttgccgagaaatcagaaggggactaatatgagccggttaacagagctgctgcaa
gtctatcatcaaaacggctgggttctctcattttcctctcttcaacaatttgcgaaagag
cttgcagaaaacatggacatatcatctgccacagttgaagtgaggtttccgtggtttttc
gaacggaaaagcccgaagcttgagaaagcgggtttgatgcatgctgatatattcatgtct
gtcacctatcgcaaagatcagccgtttaaacagcgtgccggcatctcagcaaaagtaacg
actctgtgcccttgctccaaggaaatcagcgaatacagtgcccataatcagaggggaacg
gtcagcatttgggcggatattcatccggccgcatcgctgccaagtgatgttaaagctgat
ttgcttcacgccgcagaatcaaatgcttctgcgagactgcatccggtattgaagcggcct
gatgaaaaagccgtgacagaaacggcctatgaaaatccgaggtttgttgaggatctcgcc
cggctgattgctgcagatttgtttgagcttgaatgggtgtcagcctttgagattgaatgc
cgcaatgaagaatcgatccatctccacgatgcctatgcgaagctgtgtttttcgaaggaa
gtggataaaatatga

DBGET integrated database retrieval system