KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01660Help
Entry
I653_01660        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
356126..356710
Genome map
AA seq 194 aa AA seqDB search
MKLSLFIIAVLMPACLLSACSDHAEEHASINTKKTVENITDVRKTAKTSIDWTKPSGGEY
PDIKQKHVWIDVNVKEQKAYIKEGSNTIYTMMISSGLDQTKDDATPKGTFYVEPERGEWF
FSEGYQEGAEYWVSWKNHGEFLFHSVPMTKDQKVIKTEAEKLGTKASHGCIRLTIPDAKW
VYENIPEHTKVVIS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctcattattcattattgcagttcttatgccagcctgcctgctgtcagcctgc
tccgatcatgcagaagaacacgcaagtatcaatacaaagaaaacggtcgaaaacataacg
gacgttcgaaaaacagcaaaaacaagcattgattggacaaagccttcgggcggagaatac
ccggatattaaacagaagcatgtctggattgatgtgaatgtgaaggagcagaaggcttac
atcaaggaaggaagcaacaccatctatacaatgatgatctcttctggtcttgatcaaaca
aaagatgatgctacgccaaagggcaccttttatgtagagcctgaacggggagaatggttt
ttctccgaaggataccaggaaggcgcagaatactgggtatcatggaaaaatcacggtgaa
tttctatttcatagtgtgccaatgactaaggatcaaaaagtcatcaaaacggaagcagaa
aaactaggaacgaaagcatctcacggatgtatcaggctgaccattccagatgcgaaatgg
gtatatgaaaatatccctgaacatacaaaagtggtgatcagctga

DBGET integrated database retrieval system