KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01665Help
Entry
I653_01665        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
356932..357033
Genome map
AA seq 33 aa AA seqDB search
MEQLPYASCGFPIVGKYLRWGKGLNAVGAFTDL
NT seq 102 nt NT seq  +upstreamnt  +downstreamnt
gtggagcaattgccttatgcaagctgcggttttccgattgtaggcaagtatttgcgatgg
ggaaaaggattaaacgcggttggagcctttactgatttataa

DBGET integrated database retrieval system