KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01705Help
Entry
I653_01705        CDS       T02520                                 

Definition
(GenBank) aryl-phospho-beta-d-glucosidase
  KO
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I653_01705
   00500 Starch and sucrose metabolism
    I653_01705
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     I653_01705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
361345..362778
Genome map
AA seq 477 aa AA seqDB search
MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIPGKTFKGTNGDIAVDH
YHRFKEDVALMAEMGLKAYRFSVSWPRVFPKGKGEINEAGLAFYDSLIDELLSHHIEPVL
TLYHWDLPQALMDEYGGFESRNIIKDFNHYCITLYKRFGDRVKYWVTLNEQNYNFNHGFI
TAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPEGKIGPSFAYSPAYPLSSHPEDI
LAFENAEEFMNNWWLDMYCWGTYPQIPFRYLEKQGWAPTIEAGDMELLAKGKPDFVGVNY
YQTITYERNPLDGVSEGKMNTTGQKGANQETGIPGVFKTKKNPHLTTSNWDWTIDPIGLR
IGLRRITSRYQLPVFITENGLGEFDKVENGTVQDDYRIDYLRSHLEQCRQAISDGVDLIG
YCSWSFTDLLSWLNGYQKRYGFVYVNRDEESTCDLKRLKKKSFYWYQGVIKTNGESL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatccaccagcatccagaatcttttccgaaacattttttgtggggctctgcttctgca
gcgtaccagattgaaggcgcttggaatgaagatggcaagggcccctctgtttgggatgtg
tttacgaaaataccgggcaaaacgtttaaaggaaccaatggcgacattgcggttgaccat
tatcaccgatttaaagaagatgtcgctctgatggctgagatggggttaaaagcatatcga
ttttccgtcagctggccacgggtttttccaaaaggaaaaggagagatcaatgaagcaggt
ctagcgttttacgatagtctgattgatgaattgctttctcatcacatcgagccggttctg
actttatatcactgggatttgcctcaagcgcttatggacgaatacggcgggtttgaatcc
agaaacatcataaaggattttaatcactactgtattactctttataaacgttttggagac
agggtgaaatattgggttacgttaaatgaacagaactacaattttaatcacggatttatt
acagccatgcatccgcctggagtgaaagacagaaaacgattttacgaagcaaaccatatt
gcgtttctggctaatgcaaaagccatcgaatcatttagagaatatgtgcctgaaggcaaa
ataggtcctagctttgcttattctccggcttatcctttatcaagccatccagaggatata
ctggcatttgaaaacgccgaagaatttatgaacaattggtggcttgacatgtattgctgg
ggaacctacccgcaaattccattccgctacttggaaaaacagggatgggcgccaacaatc
gaagcaggagatatggagctgcttgccaaagggaagcctgattttgtaggtgtcaattat
tatcagacaatcacctatgaacgaaatccgcttgatggtgtgtctgaagggaaaatgaat
acgacaggccaaaagggagccaatcaggagacggggatacccggagtgttcaaaacgaaa
aaaaatccgcatctgacaacgagcaactgggattggacaattgacccaattgggctgcgt
atcggtcttcgccgaattacaagccgctatcagcttccagtgtttataacagagaacggt
ttgggtgaatttgataaagttgagaacggcactgtacaggatgattatcgaattgattat
ttacgttcgcatcttgagcaatgcagacaagccatcagtgacggtgtcgatttaatcggc
tattgcagctggtcgtttactgacctgttaagctggctgaacggctaccaaaaaagatac
ggatttgtatatgtcaatcgtgatgaagaaagcacatgcgatttaaaacgcttgaagaaa
aaaagcttttattggtatcaaggtgtcatcaagacgaacggagaaagtttataa

DBGET integrated database retrieval system