KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01720Help
Entry
I653_01720        CDS       T02520                                 

Definition
(GenBank) methyl-accepting chemotaxis protein TlpC
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy02020  Two-component system
bsy02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    I653_01720
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    I653_01720
Bacterial motility proteins [BR:bsy02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    I653_01720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal sCache_3_3 Cache_3-Cache_2 sCache_3_2 dCache_3 HAMP EzrA DUF4042 Laminin_II DUF4363 BLOC1_2 Tetraspannin YkyA 7TM_GPCR_Srd DUF4446 DUF948 GAS Spc7 Imm7
Motif
Other DBs
NCBI-ProteinID: AGI27614
Position
complement(363855..365573)
Genome map
AA seq 572 aa AA seqDB search
MIKRFKMKLGTKILCLVFVVILLFSASVGTVMLKEITESMKQMATEKAKGDLALSSTYID
DVMSGDWQVKNNKLYKGQTQINGNEDIVDLLGEKTGDTITIFQGDTRVATNVMKNGERAV
GTQASSEVIAAVLKKGKRFYGQADVAGSSYQTAYMPLKDQNGNIIGMLYTGANQSILASL
TQSLFTQFAIVLVIVIMVSVILVLVFTRKINKRLNSLKSAFESAGNGDMTIEVSDKTGDE
LSELSNYYNKMRMKLNDTIQTVQQSALQLASASQQLSAGAEETNQASEKITEAVQQIANG
AQDQIARIENSESSLKQASADIRDISANTAAIADKGQLAQSKADIGQKEIANVQAQMDAI
HQSIQKSGEIIHQLDGRSKQIEQILSVITQIADQTNLLALNAAIEAARAGEQGKGFAVVA
DEVRKLAEESQQSAGQISKLIIEIQKDMNRSARSVEHVKTETAEGVTMIQRTRDAFKEIA
AATGEISAEISDLSASVTNISASAHHINDSFAANTADIKESTKNTRQAAALTEEQFAAME
EITAASETLSQLAEELTGIISQFKMINQAENG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
ttgataaaacgatttaagatgaagctaggaactaaaattctttgcctcgttttcgtggtg
attcttttgttttcggcatcagttggcactgtgatgcttaaagaaattacagaaagcatg
aaacaaatggcaactgaaaaagcgaaaggtgatctcgctttaagcagcacttatattgat
gatgtcatgtcaggcgactggcaggtgaaaaacaataagctctataaagggcaaacacaa
atcaatggaaatgaagatattgttgatctgcttggtgaaaaaacaggtgataccattacc
attttccaaggcgatactcgtgttgcaaccaatgtcatgaagaatggcgaaagagctgtc
ggcacccaggcttcttctgaagttattgccgctgttttaaagaaaggaaagcgtttttat
ggacaagcagatgtagcaggttcttcttatcagactgcatacatgccgttaaaagatcaa
aatgggaacatcatcggcatgctgtataccggagctaatcaaagtattttagcatcactt
acacaatcacttttcactcaattcgctatcgttcttgttatcgtcattatggtatcagtc
atccttgtcttggttttcaccagaaaaatcaacaagcggctgaactctttaaaaagcgcc
tttgaaagtgccggaaacggagatatgacaatagaggtgtcagacaaaaccggtgacgag
ctatcagaactaagcaactattataataagatgagaatgaagctgaacgataccatacaa
accgtacaacaatcagcccttcagcttgcgtcagcctctcagcagctctcagccggagca
gaggaaacaaatcaagcttcagaaaagatcacagaagctgtacagcagattgcaaatgga
gcccaagatcagatcgcccgaattgaaaacagtgaaagctcattaaaacaagcttcagca
gacatccgggatatttctgcaaatactgccgctatcgctgacaaagggcagctcgctcaa
tcaaaagcagacattgggcaaaaggaaattgcaaatgtacaggcgcaaatggatgcgatt
caccagtcaattcagaaaagcggagaaatcatacaccagttagacggccgctctaaacaa
attgagcaaattttatcggtcatcacccaaattgccgatcagacaaacctgcttgcgctg
aatgcagcgattgaagctgccagagccggtgaacaaggaaaaggctttgctgttgttgct
gatgaagtacggaaattagcagaagagtctcaacagtctgcagggcagatttcaaaactg
atcatagaaatacaaaaggatatgaaccggtctgcaagatctgttgagcatgtgaaaaca
gaaactgcagaaggagtcaccatgatccagcgcaccagagatgcatttaaggaaattgca
gctgcaacaggtgaaatcagcgccgagattagtgatttatcagcatctgtaacaaacatt
tcagccagtgcacatcatataaatgattcctttgcagccaatacggccgacattaaagaa
tctactaaaaatacccggcaagcggctgcattaacagaggagcaatttgctgcaatggag
gagattaccgcagcttctgaaacactttctcaattagctgaggagcttaccggtatcata
agccaatttaaaatgattaatcaagccgaaaacggctga

DBGET integrated database retrieval system