KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01735Help
Entry
I653_01735        CDS       T02520                                 

Definition
(GenBank) HTH-type transcriptional activator HxlR
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
367114..367476
Genome map
AA seq 120 aa AA seqDB search
MSRMDDKRFNCEKELTLAVIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLR
ELEQDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYMELIDIDKNIMKESL
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
ttgagccggatggacgacaaaaggtttaattgtgagaaggaattaacgcttgcagtgatt
ggcggtaaatggaaaatgctcattttgtggcatttaggaaaagaaggcacaaaacggttc
aatgaattaaaaacattgattcctgatattacgcagaagatcctcgtgaatcagctgaga
gagcttgagcaggatatgattgttcacagggaagtgtatccggttgtcccgccgaaggtt
gaatattctctgaccccgcacggagaaagcctcatgcctattcttgaagccatgtatgag
tgggggaaaggctatatggaattgattgatatcgacaaaaatatcatgaaagaatcgttg
taa

DBGET integrated database retrieval system