KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01775Help
Entry
I653_01775        CDS       T02520                                 

Definition
(GenBank) surfactin synthetase
  KO
K15657  
external thioesterase TEII
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    I653_01775
Polyketide biosynthesis proteins [BR:bsy01008]
 Nonribosomal peptide tailoring proteins
  Thioesterase
   I653_01775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
393472..394200
Genome map
AA seq 242 aa AA seqDB search
MSQLFKSFNASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAAEPPGHGTNQTSAIED
LEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLEREGVFPQAVIIFAIQPPHIQ
RKKVSRLPDDQFLDHIIQLGGMPAELVENKEVMSFFLPSFRSDYRALEQFELHDLAQIQS
PVHVFNGLGDKKCIRDAEGWKKWAKDITFHQFDGGHMFLLSQTEEVAERIFAILNQHPII
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagccaactcttcaaatcatttaatgcgtcggaaaaaacgcagctcatctgttttccg
tttgccggcggctactcggcgtcgtttcgccctctccatgcttttttgcagggggagtgc
gagatgctcgctgccgagccgccgggacacggcacgaatcaaacgtcagccattgaggat
ctcgaagagctgacggatttgtacaagcaagaactgaaccttcgccctgatcggccgttt
gtgctgttcggacacagtatgggcggaatgatcaccttcaggctggcgcaaaagcttgag
cgtgaaggcgtctttccgcaggcggttatcatttttgcaatccagccgcctcatattcag
cggaagaaagtgtcccgcctgcctgatgatcagtttctcgatcatattatccaattaggc
ggaatgcccgcagagcttgttgaaaataaggaggtcatgtcctttttcctgccttctttc
cgatcagattaccgggctcttgaacaatttgagcttcacgatctggcccagatccagtcg
cctgttcatgtctttaacgggcttggtgataaaaaatgcatacgagatgcggaaggctgg
aagaagtgggcaaaagacatcacattccatcaatttgacggcgggcacatgttcctgctg
tcacaaacggaagaagtcgcagaacggatttttgcgatcttgaatcagcatccgatcatt
caaccgtga

DBGET integrated database retrieval system