KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01795Help
Entry
I653_01795        CDS       T02520                                 

Definition
(GenBank) putative HTH-type transcriptional regulator
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 GntR Aminotran_MocR HTH_36 HTH_11 HTH_41 Rrf2 MarR HTH_Crp_2 MarR_2 HTH_27 Fe_dep_repress HTH_IclR HTH_DeoR HTH_24 PRANC TrmB
Motif
Other DBs
NCBI-ProteinID: AGI27624
Position
397215..398549
Genome map
AA seq 444 aa AA seqDB search
MEKYMSLVTRIEEMMQSTAYQEGDRLPSIRQLSARYQVSKSTVIRALQELEKRHLIYSVP
KSGYYIVKKTGKAKSGQQGPIDFATSAPDPDVFPYLDFQHCINKAIDTYKNDLFIYGTPK
GLPSLIRVLRKLLANQQVFADERHIFITSGVQQALSLLCAMPFPNGKEKIAIEQPGYHLM
VEQLETLGIPAIGVKRTEEGLDIAEVERLFQTESIKFFYTMPRFHNPLGCSLSERDKQEL
VRLAEAYDVYLVEDDYLGDLEENKKADPLYAYDLSSHVIYLKSFSKMMFPGLRVGAAVLP
EALTDTFYAYKKLNDIDCSMISQAALEIYLKSGMYGRHKEKIRDSYKERSLRLHQAIQTH
RQLGSGRFTFSSGQAPCMHTHLVLPQDLPASRVIHRLKKQGVTLEAIDRHYLSDYQKENL
LKINISNVKTEDIERGVKLLMSHL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatatatgagtctagtaacgaggatagaggagatgatgcaaagcaccgcctat
caagaaggagacaggcttccatctatccgtcagctgtccgcccgctaccaagtcagcaaa
agcacagtgatccgcgcgttgcaggagctggaaaagcgccaccttatctattctgttccg
aaaagcggctattatattgtgaaaaagacgggaaaagccaaaagcgggcagcagggtccc
atcgattttgccacatctgcgccggacccagatgtgtttccgtatcttgattttcagcac
tgtatcaacaaagcgattgatacatacaaaaacgatttgtttatttatgggacgccaaag
gggcttccatcactcatccgtgtactccgaaagctcttggctaatcagcaggtatttgcg
gatgaacggcatattttcattacatcaggtgtccagcaggcgttatctctgctttgtgcc
atgccatttccaaatgggaaagaaaagatcgccattgaacagccgggctaccatttgatg
gtcgaacagcttgagacgcttgggattcccgccatcggggtgaaacgaacggaagaaggg
cttgatatagccgaggttgagcggttatttcaaacagaatcgattaaatttttttatacg
atgccccgcttccataacccgcttggctgctctttgtcagagcgtgataaacaggagctt
gtgagactggcagaagcgtatgatgtctatctcgttgaggatgattacctcggtgatctg
gaggaaaataaaaaggcagatccgctgtacgcatatgatctgtcctcacatgtcatctat
ttgaaaagcttctcgaaaatgatgttccccggccttcgcgtgggggcggctgttttgccc
gaagcgctgactgacacgttctatgcgtacaaaaagctgaacgacatcgactgttcgatg
atttctcaagcagcattggagatttacctgaaaagcggtatgtacggcaggcataaggag
aaaatcagagattcttataaagagcggtcgctgaggctacatcaagccattcaaacacac
aggcagctgggaagcggccgctttacgttctccagcgggcaggcaccctgtatgcacacc
catttggtgcttcctcaggatctgcccgcctcaagagtgattcatagactgaaaaaacaa
ggggtgacccttgaggcgatagaccgtcattatttatcagattatcagaaagaaaatcta
ttaaaaatcaatatttccaatgtgaaaacggaagatattgagcgcggtgtcaagctgttg
atgagccatttataa

DBGET integrated database retrieval system