KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01810Help
Entry
I653_01810        CDS       T02520                                 

Definition
(GenBank) cystine ABC transporter ATP-binding protein
  KO
K10010  
cystine transport system ATP-binding protein [EC:3.6.3.-]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
ABC transporters
Module
Cystine transport system
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    I653_01810
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     I653_01810
Transporters [BR:bsy02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234] [OT]
    I653_01810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(400290..401033)
Genome map
AA seq 247 aa AA seqDB search
MLTVKGLNKSFGENEILKKIDMKIEKGKVIAILGPSGSGKTTLLRCLNALEIPNRGELAF
DDFSIDFSKKVKQADILKLRRKSGMVFQAYHLFPHRTALENVMEGPVQVQKRNKEEVRKE
AIQLLDKVGLKDKMDLYPFQLSGGQQQRVGIARALAIQPELMLFDEPTSALDPELVGEVL
KVIKDLANEGWTMVVVTHEIKFAQEVADEVIFIDGGVIVEQGPPEQIFSAPKEERTQRFL
NRILNPL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcttaccgttaaaggattaaacaaatcattcggtgaaaatgaaattttaaaaaagata
gatatgaagattgaaaaaggaaaagtcatcgccatacttgggccttcaggttcagggaaa
acgacgctgctccgctgcctgaacgctctggagatcccgaatcgcggagagcttgcattt
gatgatttctccatcgatttctccaaaaaggtgaaacaggcggatatcctaaagcttcgc
cgaaaatccggaatggtgtttcaggcgtatcacctgttcccgcaccgcacagccctcgaa
aacgtgatggagggccctgttcaggtgcaaaaacggaacaaagaggaagtcagaaaagaa
gcgattcagcttcttgataaagttggattgaaggacaaaatggatttatatccgttccag
ctttccggcggccagcagcagcgcgtcggcatcgcccgcgcactggcgattcagcctgag
ctcatgctgtttgacgaaccgacctcagcgcttgatcccgagcttgtcggagaggtgctg
aaggttatcaaggacttggccaatgaaggctggaccatggtcgtcgtgacccacgaaatc
aagttcgcacaggaagttgcggatgaagtcatcttcatcgacggcggcgttatcgtggag
caaggaccgccggagcaaattttctccgcaccaaaagaagaacggacacagcggttcttg
aaccggattttgaacccgctgtaa

DBGET integrated database retrieval system