KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01815Help
Entry
I653_01815        CDS       T02520                                 

Definition
(GenBank) cystine ABC transporter (permease)
  KO
K10009  
cystine transport system permease protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
ABC transporters
Module
Cystine transport system
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    I653_01815
Transporters [BR:bsy02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234] [OT]
    I653_01815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(401047..401751)
Genome map
AA seq 234 aa AA seqDB search
MFLNNLPALTLGTAIPWDLVQQSFWPILSGGIYYTIPLTILSFIFGMILALITALARMSK
VRPLRWVFSVYVSAIRGTPLLVQLFIIFYLFPAFNVTLDPFPSAVIAFSLNVGAYASEII
RASILSVPKGQWEAGYTIGMTHQKTLFRVILPQAFRVSIPPLSNTFISLIKDTSLASQIL
VAELFRKAQEIGARNLDQILVIYIEAAFIYWIICFLLSLVQHVIERRLDRYVAK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtttctaaataatctgccggcattgacgcttggcacggcgatcccgtgggatctggtg
cagcagtcattctggccgatactttcagggggaatctactatacgattccccttacgatt
ctttcctttatattcggaatgatcctggcgctgattacggcgcttgccagaatgtcgaaa
gtgagacctttgagatgggtgttcagcgtatacgtatccgcaatacgcggcactcctctt
ctcgttcaattgttcatcattttctatctgttcccggcctttaacgtcacattagatcca
tttccaagcgcagttatcgccttttctttaaacgtcggcgcctatgcatctgaaatcatt
cgggcatctattttatccgtgccgaaagggcaatgggaagccggctacacaattggcatg
acacatcaaaaaacgctgttccgcgtcattttgccgcaggcgtttcgtgtgtcgatcccg
ccattatccaatacctttatcagcctgattaaagatacatccctcgcctctcaaattctg
gtcgctgagctgttcagaaaagcccaggaaatcggcgcgcggaatcttgatcaaatttta
gtgatctatattgaagcagcctttatttattggattatctgcttcctgctctcactcgtc
cagcatgtcatcgaacggcgtcttgaccgctacgtggccaaataa

DBGET integrated database retrieval system