KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01825Help
Entry
I653_01825        CDS       T02520                                 

Definition
(GenBank) putative transcriptional regulator (LysR family) protein
  KO
K21755  
LysR family transcriptional regulator, salicylic acid-responsive activator of bsdBCD
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Brite
Transcription factors [BR:bsy03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    I653_01825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(402660..403532)
Genome map
AA seq 290 aa AA seqDB search
MDIRQLRYFITIAQEQKITSAAKKLHMAQPPLSRQLKQLEDELGVVLFDRNKKKQMTLTY
EGAVFLKRAKEILHRFEDAVIEVQELKEEVAGTLAVGSTIYCAALMLEKVTQIKERYPHL
TFNIWENEPATLLELLESRQIDAAVTTTLIKSDTVQFKQLDDIPCVLVLSDEAGYPCGDT
IKMEDIPSFPLILLRPVNGKGVYNQVMNEFHRLNLEPRIVCECHDSATLLSLVSSGFGAS
ILPVTMIPVHMRNHVHTVHIENNPFIMTPAVMWRTDSYLPKPAQQFLDLF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
ttggatattcgccagcttcgatacttcattaccattgcccaagaacagaaaatcacgtcc
gcagccaaaaagcttcacatggcgcagccgcctttaagcaggcagctcaaacagctggag
gacgaacttggtgttgttctgtttgaccgtaacaagaaaaaacaaatgactcttacatat
gaaggagctgtttttctaaaaagagcaaaagagattctgcataggtttgaagatgcagtc
attgaggtacaggagctgaaggaggaagtagccggcacacttgccgtgggatcaacgatt
tattgcgcggctctgatgcttgaaaaagtaacacagatcaaagagagatacccccatctc
acctttaatatttgggaaaatgagcccgcgacactgttggaactgctggaaagccggcaa
atcgatgcggcggtcacgacaacactgatcaaaagtgacacagtacaattcaagcagctt
gatgacattccatgtgtgctcgtgctttcagatgaagccggatatccgtgcggagacacc
attaagatggaggacattccttcatttccgctgatcctgctgaggcctgtcaacggaaaa
ggcgtctataatcaggtcatgaatgaatttcatcgtttgaacctggagccgcgcattgtt
tgtgaatgccacgactctgcaactttgctcagcctcgtgtcatccggattcggcgcgtct
attttgcccgtcacaatgattcccgttcatatgagaaatcacgttcacaccgtccatatc
gaaaataatcccttcattatgacaccggctgtcatgtggagaacggacagttatttgcct
aaaccggcacagcaatttttggatttattttaa

DBGET integrated database retrieval system