KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01830Help
Entry
I653_01830        CDS       T02520                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  
flavin prenyltransferase [EC:2.5.1.129]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Aminobenzoate degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    I653_01830
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    I653_01830
Enzymes [BR:bsy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     I653_01830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
403658..404236
Genome map
AA seq 192 aa AA seqDB search
MKLVVGMTGATGAIFGVRLLQWLKAAGVETHLVVSPWANVTIKHETGYTLQEVEQLATYT
YSHKDQAAAISSGSFDTDGMIVAPCSMKSLASIRTGMADNLLTRAADVMLKERKKLVLLT
RETPLNQIHLENMLALTKMGTIILPPMPAFYNQPSSLEEMVDHIVFRTLDQFGIRLPEAK
RWNGIEKQKGGA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcgttgtcggaatgacaggggcaacaggggccattttcggggtcaggctgctg
cagtggctgaaggccgccggagtggaaacccatctcgttgtgtctccttgggcaaacgtc
acgatcaaacacgaaacaggctataccttacaagaagtagaacaactggccacatacact
tactcacataaggatcaggcggcagccatttcaagcgggtcgtttgataccgatggaatg
attgttgcgccgtgcagcatgaaatctctcgcaagcattcgcaccggaatggcggataat
ctgctgacacgtgcggcggatgtcatgctcaaggagagaaaaaaactcgtcctcttaacg
agagagacgcctttgaaccaaatacatctcgaaaatatgctagcgcttacgaaaatgggc
accatcattcttcctccgatgccggcattttataatcagccgagcagcttagaggaaatg
gttgaccatattgtattcagaacgttggaccaattcggcattcggcttcctgaagcgaaa
cgctggaatgggattgaaaaacaaaaaggaggagcttga

DBGET integrated database retrieval system