KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01840Help
Entry
I653_01840        CDS       T02520                                 

Definition
(GenBank) Nonoxidative vanillate/4-hydroxybenzoatedecarboxylase
  KO
K21759  
vanillate/4-hydroxybenzoate decarboxylase subunit D [EC:4.1.1.- 4.1.1.61]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Aminobenzoate degradation
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    I653_01840
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    I653_01840
Enzymes [BR:bsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.61  4-hydroxybenzoate decarboxylase
     I653_01840
    4.1.1.-  
     I653_01840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
405677..405904
Genome map
AA seq 75 aa AA seqDB search
MHTCPRCDSKKGEVMSKSPVEGAWEVYQCQTCFFTWRSCEPESITNPEKYNPAFKIDPKE
TETAIEVPAVPERKA
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgcatacatgtcctcgatgtgactcaaaaaagggagaagtcatgagcaaatcgcctgta
gaaggcgcatgggaagtttatcagtgccaaacatgctttttcacatggagatcctgtgaa
ccggaaagcattacaaatcccgaaaaatacaatccagcgtttaaaattgatccaaaggaa
acagaaacagcaattgaagttccggcggtgccggaacgaaaggcttga

DBGET integrated database retrieval system