KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01860Help
Entry
I653_01860        CDS       T02520                                 

Definition
(GenBank) putative uronase
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
409075..410829
Genome map
AA seq 584 aa AA seqDB search
MAEFILNAADFGVPGDGKTDSTERINQCLSTAVSKGYHTVWFPKGTYLIDGTLGGDLNQK
FRNAGIIVPGNLEIMMDPECIMKVIPNSSWGYSAFYVGKQENITISGGQIIGERDEHTYA
SAGIRSTHEWGFGICIEGCSNVVIDDVKISDFTGDGIIVSPRGLKTNQDYRTSEQIIIRR
CEVRRSRRNNISITGCDMVTVEECLIEDAGTGNGTAPKFGIDIEGYGEGDVDYEEPINVS
IRNNHFVGNVSSSVTNFNGYGILIEGNHSDNTISYGYGTQTVIKGNILRRPEDAAAAPRV
GITGLGVSQGKESSDAVIAGNLITGFSTGIDVRGKSVLVTNNKISNFENTGILVYQSFDV
KVDGNQIQNGLSETRRSIGLRAVLSDDTAFLNNCLIQVVDGVNVSGGNMIIKDNLLRKFS
RGIWIAQGNAVIEGNTLNPDAFEAVPESYSVSVTNNAGAIIKNNTFKEFKNYPIYCSTSA
KTSIIGNHLERSPLLVTIYISAGVHEIFDNTISVNRTAGNPIVIYINGSAGSIISGNTIN
NLSAGTAIAIQTNTATNSKIIGNRIFKGTINKHSSDTIDGNIIV
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
ttggctgaattcatattaaatgcagcggatttcggtgttcctggagatggtaaaacggat
tcgacagaacggattaatcagtgcctcagtacagctgtatcgaaaggctatcatactgtc
tggtttccaaagggaacatatttaatagacggaacgcttggcggagatcttaatcagaag
tttcgaaacgcggggatcattgttcccggcaaccttgagattatgatggaccccgaatgt
atcatgaaagtgataccgaatagttcgtggggttattccgcattttatgtaggcaagcaa
gagaatataaccatttccgggggacaaattatcggcgaacgggatgagcatacgtatgct
tcggcggggataagatcaacccatgaatggggctttggcatatgtattgaaggatgctcg
aatgttgtcattgatgatgtgaaaatttctgattttaccggcgatgggatcatagtcagc
ccaaggggattaaagaccaatcaagattatcgaacgtcagagcaaattatcatccgccgc
tgtgaggttcggcggtcgaggagaaataacatttccattaccggatgtgacatggtcacg
gtggaggaatgcttgattgaagatgccggaacggggaatggaacagcgccgaaattcgga
attgacattgaaggatatggcgaaggtgacgttgattatgaggaaccgattaatgtatca
attcgcaataaccactttgttggaaacgtttcaagttctgtgaccaattttaacgggtat
ggcattttaatagaaggaaatcactcagacaatacaatcagctacggatatgggacgcaa
acagtgatcaaaggaaatatactgagacgccctgaagacgcggcggctgcgccaagagtc
gggataaccggactcggtgtatcacaaggaaaagagtccagtgatgcagtgatcgctggc
aacctcattaccggattttcaacaggaattgatgtcaggggaaagagcgttcttgtgacg
aacaacaaaatcagcaactttgaaaacacagggatattggtttatcaatccttcgacgta
aaggtagacggaaaccaaattcaaaacggactgtctgaaacaaggcgcagcatcggtctt
cgtgcagtgctgtcagatgacaccgcttttctgaataactgtctcattcaagtcgttgac
ggtgtgaacgtttccggcggaaatatgatcattaaagataatctcctgagaaaattcagc
cggggcatttggattgctcaagggaacgcggtgattgaagggaatacactgaatcctgat
gcgtttgaagcagtgccggaatcatattctgtttccgtcacaaacaatgccggcgctatc
atcaaaaacaatacatttaaagagttcaaaaattaccccatttattgctccacaagtgca
aaaacctcaattatcggcaaccacttagagagatctccgcttttggtcaccatctatatc
agcgccggtgtgcatgagatttttgataataccatttcagtcaacagaacagccgggaat
ccgattgtgatttatatcaatggctcggcaggctctatcatctcaggaaacaccatcaat
aacctctccgcgggcactgcgatagctattcaaacaaacacggcaaccaattctaaaatc
atcggcaaccgcatttttaaagggaccatcaacaaacacagcagtgacacaatagacggc
aatattattgtctga

DBGET integrated database retrieval system