KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01865Help
Entry
I653_01865        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(410844..411065)
Genome map
AA seq 73 aa AA seqDB search
MKILGVTGVILICLLAISVLMDMLQGFSLTKAIYNNMSSFKMTTFAEWVVLLFFVLVLVR
EMYVIYKSKKKNP
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattgggcgtgacaggagttatattaatttgtttattagctatttctgtattg
atggacatgcttcaagggttcagtttaacaaaagccatttataacaatatgtccagcttt
aagatgacaacatttgcggaatgggtcgtgcttttattttttgttttagtacttgtgaga
gaaatgtacgtgatctataaatcgaaaaaaaagaacccctag

DBGET integrated database retrieval system