KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01870Help
Entry
I653_01870        CDS       T02520                                 

Definition
(GenBank) spore germination receptor subunit
  KO
K06295  
spore germination protein KA
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
411191..412825
Genome map
AA seq 544 aa AA seqDB search
MPLFSKQKNNTDSKDKQNTDERNQEQQQEKERPVLISPSLAKNIAETKKEVGSSSDVIIR
EIKIGEQDHVHLAVIYIAGLVDNNTIHESLIDPLVQDESIQNSHAIQQILEKTLPLGGVK
AEKSWGKLFSELMLGNALVFADGYDEALICSTQGGEQRSIQEPSTQVSFRGPRQGFTESL
QTNISMIRRYIKNPNLWVEKMKKGSVTNTDIALMYIQGICDEKVLKEVKQRLEKIDIDSI
LESGYIEQLIEDETFTTFPTMYHTERPDVVAGNLLEGRFAIIVDGTPFVLIAPALFVQFF
QSVEDYYSRFDIATSIRILRVLVFFISLVAPAVYVAATTFHQEMIPTQLLVVIAAQREIV
PFPAVVEALTMEVAFEILREAGVRLPRVVGSAVSIVGALVIGQAAVQAGIVSPAMVIVVA
LTAIASFATPAFAMAISARLIRFIFIIASAVLGFYGLILGIIMMFVHLCSLRSFGVPYMS
PLAPFSSQGVKDALFRVPWWADEKRPESVSKEDKVRQGQDQRPEPAASRGMVNKDLEEGD
QNGT
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcctttattttctaagcaaaagaacaataccgattcaaaagacaagcagaatacagac
gaaaggaatcaggaacagcagcaagaaaaagaaaggccggttctcatttctccaagtttg
gcaaagaatatagcggaaacgaaaaaggaagtcggaagcagctctgacgtcatcattcgt
gagattaaaatcggggagcaggatcatgtccatttggctgttatttatattgcaggcctg
gtcgataataacacaatccatgagtcgttaatcgatcctttggtacaggatgagtctatc
cagaattcccatgcgatccagcaaattcttgaaaaaacgctccccctgggcggagtgaaa
gcggaaaagagctggggcaagcttttttccgagttaatgctcggcaatgcgctcgttttt
gcagatggctatgatgaagctttgatttgcagcactcaagggggagagcagcgctccatc
caagagccgagcacccaggtgtcattccgcggcccgcgccaagggtttacagagtctctg
caaaccaatatttccatgatccggcgatacattaaaaatccgaatttatgggttgaaaaa
atgaaaaaaggttctgttacgaatacggatatcgctctcatgtacattcaaggaatatgt
gatgaaaaggtgctgaaggaagtgaaacagcgcctggaaaaaatagatattgacagtatt
ttggaatctggatatattgagcagctgattgaagatgaaacctttacgacatttccgacc
atgtatcatacagaacgtcctgatgttgtagcgggaaatctgttagaaggaagattcgcg
ataattgtggacggaacaccgtttgtgcttattgctccggccttatttgttcaatttttt
cagtctgttgaggattattattcacgttttgacattgcgacaagcatacggattcttcgc
gttttagtctttttcatttcgcttgtggctccggctgtatacgtggcagccacgacgttt
catcaagaaatgataccgactcagctgttagtggtcattgcggcccagcgggaaattgtt
ccgtttccggctgttgtggaggcgctgacgatggaggttgcttttgagattctgagggaa
gcgggagtcaggctgccccgggttgtcggctcggcagtatcaatcgtaggcgcgctcgta
atcggccaggctgccgtacaggctggtatcgtctctccggcaatggttattgtcgttgca
ctcaccgcgattgcgagcttcgcaacacctgcgttcgcgatggccatttcagcccggctt
attcggtttatttttattattgcctcagctgttttgggtttttacgggctgattttaggg
atcattatgatgtttgtccacttatgcagtcttcgttcattcggcgttccatatatgtcg
ccgcttgcacctttttcttcacaaggcgtaaaggacgcgcttttccgtgttccgtggtgg
gccgatgaaaaaaggccggaatcggtcagtaaggaagataaggtgcggcaggggcaagat
caacgcccagagccggccgcttcacgaggaatggtgaacaaagatttggaagaaggggat
cagaatggtacgtaa

DBGET integrated database retrieval system