KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01905Help
Entry
I653_01905        CDS       T02520                                 

Definition
(GenBank) response regulator aspartate phosphatase
  KO
K06361  
response regulator aspartate phosphatase C [EC:3.1.-.-]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    I653_01905
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     I653_01905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
419913..421061
Genome map
AA seq 382 aa AA seqDB search
MKSGVIPSSAVGQKINEWYRYIRTFSVPDAEVLKAEIQQELKHMQHDSNLLLYYSLMEFR
HQLMLDYLEPLEKLNIEDQPSLSELSRNIDSNQADLKGLLDYYVNFFRGMYEFDKREFIS
AITYYKQAEKKLSFVADHIERAEFYFKIAEAYYYMKQTYFSLINIKNAYEIYVEQETYNV
RIIQCHFVFGVNLMDERNFEQAARHFKLALNMAQAEQKAQLVGRAYYNLGLCYYNQDLLD
PAIDYFEKAVSTFESSRIVNSLPQAYFLITLIYYKQGKHDKASEYHKRGYEYAKETDDAD
YAVKFEFLQSLYQDQPNEEGIERCFQYLKNKNMYADIEDLALEVAKYYYEQKWFKLSASY
FLQVEEARKQIQRSEGLYEIEI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcggggtaattccttcttcagcggtcggtcaaaaaattaacgagtggtacaga
tatatccggacattcagcgtgccggatgccgaagtgttaaaagctgaaatccagcaggaa
ctgaaacacatgcagcatgattccaacttgctgctttattattcactaatggaattccgg
caccagcttatgctggattatcttgagccgttagagaaattaaatatcgaagaccagcca
agcctgtctgaattatcaagaaacattgacagcaaccaggcagatctcaaagggctgctc
gactattacgtgaatttttttcgcgggatgtatgagtttgataagcgggaatttatttct
gccattacatactataaacaggcggagaaaaagctctcctttgtcgcagaccatattgaa
cgggctgaattctattttaaaatcgcggaagcttattattatatgaagcaaacgtatttt
tcattgattaatataaaaaacgcttatgaaatttacgtggagcaggaaacctataatgtg
agaatcattcaatgccatttcgtgttcggggtcaacctgatggatgaaagaaatttcgaa
caagccgcacgccatttcaaattggcgctcaatatggcccaagcggaacaaaaagcccag
ctggtcggaagagcatactacaatctcggattatgctattacaatcaagaccttctagac
cctgccattgattactttgaaaaagcggtctccacgtttgaaagcagcaggatcgtcaat
tctctcccgcaagcctattttttaatcaccctgatttattataaacagggaaaacatgat
aaagcttcggaatatcacaagcggggctatgaatatgctaaagaaacagacgatgcagac
tatgccgtaaaattcgagtttttgcaatccctatatcaggatcagcccaatgaagaagga
atcgaacgatgtttccaatacttaaaaaataaaaatatgtacgctgatatagaggattta
gccctagaagtagcaaaatactactatgaacagaaatggtttaaactgtctgcttcctat
tttctacaagttgaagaggcaagaaaacaaatacaaaggagtgaaggtttgtatgaaatt
gaaatctaa

DBGET integrated database retrieval system