KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01925Help
Entry
I653_01925        CDS       T02520                                 

Definition
(GenBank) aspartate kinase
  KO
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Methionine biosynthesis, apartate => homoserine => methionine
Threonine biosynthesis, aspartate => homoserine => threonine
Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    I653_01925
   01230 Biosynthesis of amino acids
    I653_01925
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    I653_01925
   00270 Cysteine and methionine metabolism
    I653_01925
   00300 Lysine biosynthesis
    I653_01925
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    I653_01925
Enzymes [BR:bsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     I653_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(421704..423068)
Genome map
AA seq 454 aa AA seqDB search
MKVVKFGGSSLASGAQLDKVFHIVTSDPARKAVVVSAPGKRYAEDTKVTDLLIACAKQYL
ETGSAPELAEAVVERYALIANELQLGQSIIEKIRDDLFTLLEGDKSNPEQYLDAVKASGE
DNNAKLIAAYFRYKGVKAEYVNPKDAGLFVTNEPGNAQVLPESYQNLYRLRERDGLIIFP
GFFGFSKDGDVITFSRSGSDITGSILANGLQADLYENFTDVDAVYSVNPSFVQNPKEISE
LTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPSAEGTRVVSKRDNTNGPVVG
IASDTGFCSIYISKYLMNREIGFGRRALQILEENGLTYEHVPSGIDDMTIILRQGQMDAV
TERSVIKRIEEDLHADEVIVEHHLALIMVVGEAMRHNVGTTARAAKALSEAQVNIEMINQ
GSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgttaaattcggaggcagctcacttgcttcaggcgcccagcttgacaaggtg
tttcacatcgttacctcagacccggcacggaaagctgtagtcgtttcagctccgggaaaa
cgctatgccgaggatacgaaagtgactgatctcttaatcgcatgtgcaaaacaatatttg
gaaacaggcagcgcacctgaactggcggaagctgttgtggaacggtacgctctcatcgcc
aatgagcttcagctggggcaaagcattatcgaaaaaatcagagatgatctgtttacgctt
ttagaaggagataaaagcaatcccgagcaataccttgacgcagtcaaggccagcggggag
gataacaatgccaagctgattgccgcttatttccgctataaaggcgtcaaagcggaatat
gtaaacccgaaggatgccggcctctttgtgacaaatgaacccggcaacgcgcaagttctt
cctgaatcctatcaaaacctctatcgtcttcgggaacgtgacggactcatcatttttccc
ggttttttcggattcagcaaggatggcgatgtgatcacattctcacggagcggttctgat
attaccggttcgattcttgccaacggacttcaagccgatttgtacgaaaactttacagac
gtagacgctgtgtattctgtcaatccgtccttcgttcagaatccaaaggaaatcagcgag
ctgacatacagagagatgcgggagctgtcctacgcgggtttttcagtgtttcatgatgaa
gcgctcattccggcattcagagcggggattcctgttcagatcaaaaatacgaacaacccc
tcagccgaaggcacccgcgtcgtcagcaagcgggataacacaaacgggcctgtcgtcggc
attgccagcgacactggtttttgcagcatttatatcagcaagtatctcatgaacagagaa
atcggttttggccgcagagcccttcaaatcctggaggagaatggtttgacgtatgagcat
gttccatcgggaatcgatgacatgacgatcattttacggcaggggcaaatggatgccgtc
actgagcgcagcgtcatcaaacggatcgaagaggatttgcatgccgatgaagtcatcgtc
gagcatcatctcgccctgattatggttgtaggggaagcgatgcgccacaatgtcggtaca
acggcaagagccgccaaagcattatcagaggcacaggtgaatatcgaaatgatcaatcag
ggatcttctgaagtaagcatgatgtttggcgtaaaagaagccgaagaaagaaaagccgtt
caagcgttataccaggaatttttcgcgggcgtgctgatctcttaa

DBGET integrated database retrieval system