KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01935Help
Entry
I653_01935        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
  KO
K02015  
iron complex transport system permease protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    I653_01935
Transporters [BR:bsy02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    I653_01935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
424396..425343
Genome map
AA seq 315 aa AA seqDB search
MRNQMKIALLVVLAIVCIGLFLFYDLGNWGYTLPRRIKKVAAIVLTGGAIAFSTMIFQTI
TNNRILTPSILGLDSLYMLIQTGIIFLFGSANMVIMNKNINFIISVLLMILFSLVLYQIM
FKGEGRNIFFLLLIGIVFGTLFSSLSSFMQMLIDPNEFQVVQDKMFASFNNINTDLLWLA
FIIFLLTGVYVWRFTKFFDVLSLGREHAVNLGIDYDKVVKQMLIVVAILVSVSTALVGPI
MFLGLLVVNLAREFLKTYKHSYLIAGSVFISIIALVGGQFVVEKVFTFSTTLSVIINFAG
GIYFIYLLLKENKSW
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaccagatgaaaatagctttgctcgttgttttagccattgtatgtattggcttg
tttctgttttatgacttaggcaattggggttacaccctgccgagacgaatcaaaaaagtc
gctgccattgtgctgacggggggagcgattgcgttttcgaccatgatctttcaaacgatt
acgaacaaccgcatcctgacgccgagcattttgggccttgattctctctacatgctgatt
cagactggcattatctttttgttcggttctgcgaatatggtcatcatgaataaaaacatc
aactttatcatatctgttctgctgatgatcctgttttctcttgttttgtatcagatcatg
ttcaagggtgaggggagaaatatctttttccttctgcttatcggaatcgtgtttggcacg
ctgttcagcagcctgtcttcctttatgcagatgctgattgatccgaacgagttccaagtt
gtgcaggacaagatgtttgccagctttaacaatatcaatacggatttgttatggctcgcg
ttcatcatcttcctgctgacaggcgtttatgtctggcgttttacaaaatttttcgatgtg
ctgtcgctcggacgcgagcacgccgtgaatttgggcattgactacgacaaagtggtgaag
cagatgctgatcgtggttgcgattttggtttctgtttcaacagcgctagtcgggccgatt
atgtttttaggccttctggtcgtcaacctggcgagagaattcctgaaaacctataagcat
tcatacttaatcgcaggctccgttttcatcagcatcattgcgctggtcggagggcagttt
gtggttgagaaagtgtttaccttctcaacgacgctgagcgtcattattaattttgccggc
gggatttattttatctacttgctgttaaaggagaataaatcatggtag

DBGET integrated database retrieval system