KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01940Help
Entry
I653_01940        CDS       T02520                                 

Definition
(GenBank) iron-siderophore ABC transporter ATP-binding protein
  KO
K02013  
iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    I653_01940
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     I653_01940
Transporters [BR:bsy02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    I653_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
425337..426095
Genome map
AA seq 252 aa AA seqDB search
MVEVRNVSKQYGGKVVLEETSVTIQKGKITSFIGPNGAGKSTLLSIMSRLIKKDSGEIYI
DGQEIGACDSKELAKKMSILKQANQINIRLTIKDLVSFGRFPYSQGRLTEEDWVHINQAL
SYMKLEDIQDKYLDQLSGGQCQRAFIAMVIAQDTDYIFLDEPLNNLDMKHSVEIMKLLKR
LVEELGKKIVIVIHDINFASVYSDYIVALKNGRIVKEGPPEEMIETSVLEEIYDMTIPIQ
TIDNQRIGVYFS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggtagaggtcagaaatgtaagcaaacaatatggcgggaaagttgtccttgaagagacg
tcagtcacgattcaaaagggcaaaatcacctcgtttatcggtcctaacggcgccggcaaa
agtacgctgctgtctatcatgagccgcctgatcaaaaaagattccggcgagatttacata
gacggacaagagattggagcatgtgacagcaaagagcttgccaagaaaatgagcattttg
aagcaggcgaaccaaatcaatatcaggctcacgatcaaagacctcgttagttttggcagg
tttccgtactcacagggccggctgacagaggaagactgggttcatatcaaccaggcgctt
agctatatgaagctggaagacattcaagacaaatacttggatcagctgagcggcggacag
tgccaaagggcatttatcgctatggtcattgcccaggacacagattatatctttctggat
gagccgctgaacaatctggatatgaaacactcagttgaaattatgaaactgctgaaacgg
ctggtagaggagcttggaaaaaagatcgtgatcgtcattcacgatatcaattttgcttca
gtctattctgactatatcgtcgctttgaaaaacggccgaatcgtaaaagaaggaccgcct
gaagaaatgatagaaacatcagtgcttgaggaaatctacgatatgaccatcccgattcag
acgattgataatcaaagaataggtgtctatttttcttaa

DBGET integrated database retrieval system