KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01950Help
Entry
I653_01950        CDS       T02520                                 

Definition
(GenBank) putative efflux transporter
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(427117..428535)
Genome map
AA seq 472 aa AA seqDB search
MNTSIEQKPFNRSVIVGILLAGAFVAILNQTLLITALPHIMRDFNVDANQAQWLTTSFML
TNGILIPITAFLIEKFTSRALLITAMSIFTVGTVVGAFAPNFPVLLTARIIQAAGAGIMM
PLMQTVFLTIFPIEKRGQAMGMVGLVISFAPAIGPTLSGWAVEAFSWRSLFYIILPFAVI
DLILASILMKNVTTLRKTQIDILSVILSTFGFGGLLYGFSSVGSYGWSSSTVLISLLVGV
IALLLFITRQMKLEKPMLEFRVFTFGVFSLTTLLGTLVFALLIGTETILPLYTQNVRDVT
AFDTGLMLLPGAVVMGFMSPIIGRIFDRVGGRGLAIAGFCIIFLTSLPFMQLTDHTSLAW
IVVLYTVRLLGTAMIMMPVTTAGINALPRHLIPHGTAMNNTIRQVGGSIGTALLVSVMSN
QAAHAGTTNVKHAALHGMNAAFIVAAVIALVGFLLSFTLKKPQRPAEQQPAR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacaagtattgaacaaaaaccttttaaccgttctgtcattgtcggcattttgtta
gccggagcgtttgtggcgattttgaaccagacattgttgattaccgcacttccccatatc
atgagggatttcaatgtcgatgccaaccaagcacaatggctgaccacatcatttatgtta
accaacgggattttaattccgattactgcgtttttaattgagaaattcacaagccgggcg
ctgctcatcacagcaatgagcattttcactgtcggaacagtcgtcggagcgttcgcgccg
aacttcccggttctgctgacagcacgtatcattcaagcggctggagccggcattatgatg
ccgctcatgcagactgtattcctgacaatctttccgattgaaaagcgcggccaggctatg
ggtatggtcggattggtcatctcattcgcgcctgcgatcggaccgactctttccggatgg
gctgtcgaagctttctcttggagatcattgttttatattattcttccgtttgctgtgatt
gatttgattcttgccagcatcctgatgaaaaacgtgacgactttaagaaaaacacagatt
gatattttatcagtcatcctttcaacatttgggttcggcggccttctatacggcttctca
agcgtcggctcttacggctggtccagttcaaccgtcttgatttcactgctggtgggtgtc
atcgcgctgctcttgtttatcacaagacaaatgaagcttgaaaaaccgatgctggaattc
cgcgtcttcacgtttggtgttttcagtttaacaacactgctgggaaccctcgtctttgca
ttattgatcggtacggaaaccatcctgccgctttatacacaaaatgtcagagacgtcaca
gcttttgatacagggcttatgctccttccgggagccgttgtgatgggctttatgtcgccg
attatcggcagaatttttgaccgtgtcggcggaagagggctggcgattgccggtttctgc
atcatcttcctgacatctctgccgtttatgcagctgactgaccatacatcactcgcttgg
attgtcgttttatacactgttcgtctcttaggcaccgccatgatcatgatgccggtgaca
acagccggaatcaacgcgcttccgcgccacttgattccgcacggaactgcgatgaacaac
acgattcgccaagtcggcggctcgatcggaaccgcactattggtttccgtgatgagcaac
caggcggcacatgcaggcacgacaaatgtgaagcacgccgccctgcacggcatgaacgcc
gcttttattgtggctgccgtcattgcacttgtcggcttccttctctcattcacattaaag
aaacctcagcgccctgccgaacagcagccggcacgctga

DBGET integrated database retrieval system