KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01975Help
Entry
I653_01975        CDS       T02520                                 

Definition
(GenBank) transcriptional regulator (GntR/MocR family) with PLP binding site
  KO
K00375  
GntR family transcriptional regulator / MocR family aminotransferase
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Brite
Transcription factors [BR:bsy03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    I653_01975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(431106..432545)
Genome map
AA seq 479 aa AA seqDB search
MDITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAY
QQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTD
HFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAG
TQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPD
VLVTTPSHQFPAGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDR
FQNVIYMGTFSKSLLPGLRISYMVLPPELLRTYKQRGYDLQTCSSLTQLTLQEFIESGEY
QKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAG
LQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQEGVQRLFKAVYGHKKIPVTGD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggatatcacgattacactcgatcgttcagaacaagccgattatatctatcagcaaatt
tatcaaaagctgaaaaaagaaatcctcagccgcaatctgctgccgcactcgaaggttccc
tccaagcgggagctggctgaaaatctcaaggtcagcgtaaattcagtgaattcagcctat
cagcagctgctggctgaagggtatttgtacgccattgaacgaaagggtttcttcgtggag
gagctagacatgttttccgccgaggagcaccctccatttgcactgccggatgacctaaaa
gagattcacatcgatcagagcgattggatatcgttttcacacatgagttccgatacagac
cattttccgatcaaaagctggttccgctgcgagcaaaaagcggcctcccgttcataccgc
acgctcggcgatatgtcacatccgcaagggatatatgaagtgagagcggccattaccagg
ctcatttccctgacgaggggtgtaaaatgcaggccggaacaaatgatcataggggcaggc
acacaggtgctcatgcagctgttgactgagcttttacccaaggaagccgtgtatgcgatg
gaggagcctggctacaggcgcatgtatcagcttttgaagaatgccggaaaacaagtcaag
acgatcatgctggatgaaaaaggcatgtcgattgctgaaatcaccagacagcagcctgat
gtgctggtgaccaccccgtcgcatcagtttccggccggaacgattatgcctgtatccaga
agaattcagctgctgaactgggcagccgaggagccgcgccgatatatcattgaggacgat
tatgatagtgaattcacatatgatgtagacagtattccggcgctgcaaagcctcgaccgt
tttcaaaatgtcatctatatgggaaccttttcaaaatcccttctccccggcttgcggatc
agctatatggtgttgccgcctgagctgttgaggacatacaaacagcggggctatgatctg
cagacttgctcatcacttacacagctcaccctgcaggaatttatcgagtctggtgaatat
cagaagcatataaaaaaaatgaagcagcattataaagaaaagagagaacgcctgatcacc
gctttagaagcagagttcagtggagaggttaccgtaaaaggggcaaatgcggggctgcat
tttgttaccgaatttgataccaggcgcaccgaacaagacatcctgtcacatgctgccggg
ctgcagcttgaaatattcggaatgagccgatttaacttgaaggaaaacaagcggcaaacg
ggcaggccagctctcattatcggctttgcacggctgaaggaagaagatattcaggagggt
gtgcagcggcttttcaaagcggtttacggacataaaaaaatccccgttacaggggattga

DBGET integrated database retrieval system