KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01980Help
Entry
I653_01980        CDS       T02520                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    I653_01980
   00650 Butanoate metabolism
    I653_01980
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I653_01980
   00280 Valine, leucine and isoleucine degradation
    I653_01980
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    I653_01980
Enzymes [BR:bsy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     I653_01980
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     I653_01980
Amino acid related enzymes [BR:bsy01007]
 Aminotransferase (transaminase)
  Class III
   I653_01980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
432651..433961
Genome map
AA seq 436 aa AA seqDB search
MSQTTASITTAQWQQKRDQFVSKGVSNGNRSLAVKGEGAELYDLDGRRFIDFAGAIGTLN
VGHSHPKVVEAVKRQAEELIHPGFNVMMYPTYIELAEKLCGIAPGSHGKKAIFLNSGAEA
VENAVKIARKYTKRQGVVSFTRGFHGRTNMTMSMTSKVKPYKFGFGPFAPEVYQAPFPYY
YQKPAGMSDESYDDMVIQAFNDFFIASVAPETVACVVMEPVQGEGGFIIPSKRFVQHVAS
FCKEHGIVFVADEIQTGFARTGTYFAIEHFDVVPDLITVSKSLAAGLPLSGVIGRAEMLD
AAAPGELGGTYAGSPLGCAAALAVLDIIEEEGLNERSEEIGKIIEDKAYEWKQEFPFIGD
TRRLGAMAAIEIVKDSDTREPDKAKAAAIAAYANQNGLLLLTAGINGNIIRFLTPLVISD
SLLNEGLSILEAGLRA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaacaacagcaagcatcacaactgcacaatggcagcaaaaacgggatcaattt
gtgtcaaaaggtgtgagcaacggcaaccgcagtctggcggtcaaaggagaaggggccgag
ctgtacgatctggacggccggagatttattgattttgcaggcgccatcggcacgttaaat
gtcggacactcgcatccgaaggtggttgaggctgtgaagcggcaggcggaggagctgatt
catcctggcttcaatgtcatgatgtacccgacttatatcgagttagccgaaaaactgtgc
ggcatagcaccgggcagccatgggaaaaaagcgatttttcttaactcaggggcggaagcg
gtcgaaaacgctgtgaaaattgccagaaagtatacaaagcgccaaggcgttgtctcgttt
acgcgcgggtttcatggacgcacgaatatgacgatgagcatgacaagcaaggtaaaacct
tataaattcggtttcggaccttttgcgccagaggtttatcaagcgccgttcccttattat
tatcagaagccggccggcatgagtgatgaaagctatgacgatatggtcattcaagcattc
aatgatttttttatcgcttcagtggcgcctgaaacggtggcgtgtgtcgtgatggagcca
gtgcagggagaaggcgggtttattattccttcgaaacggttcgtgcagcacgtcgcttca
ttctgcaaagaacacggcattgtttttgttgctgatgaaatccaaaccggctttgccaga
actggcacttatttcgcaattgagcactttgatgtagtgcccgatctgatcacggtttct
aaatcgcttgcggcaggcctgccattaagcggtgtgatcgggcgtgcggaaatgcttgat
gcggcagcgccaggggagctgggcggcacgtatgccggcagcccgctcggctgcgcggcg
gctttggcagtcttggatattatcgaagaagaaggactgaatgagcgatctgaagaaatt
ggcaaaatcattgaagacaaggcgtatgagtggaaacaagaattcccgttcatcggtgac
acccgcagactcggggcgatggccgcaatcgaaatcgtcaaggattcagacacgcgtgag
cctgataaagcaaaagcagcagcgatcgcggcctatgcgaatcaaaacggattacttttg
ctgacagcgggaattaacggtaatatcatccgctttttgacaccgctcgtcatctcagac
agccttttaaatgaagggctcagcatcttggaggcgggcctgcgagcttaa

DBGET integrated database retrieval system