KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01985Help
Entry
I653_01985        CDS       T02520                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K00135  
succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Tyrosine metabolism
Butanoate metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    I653_01985
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I653_01985
   00310 Lysine degradation
    I653_01985
   00350 Tyrosine metabolism
    I653_01985
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    I653_01985
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     I653_01985
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     I653_01985
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     I653_01985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
434030..435418
Genome map
AA seq 462 aa AA seqDB search
MPDQLTVYNPATGEEIKTIPQQSATEVEEAIERSHQAFKTWSKTSANERASLLKKWYELI
VEHKEELADLITKENGKPYQEAVGEVLYGAGYIEWFAEEAKRVYGRTVPAPTTGKRIVVT
RQPVGPVAAITPWNFPNAMITRKAAPALAAGCTFIIKPAPDTPLSAYELARLAYEAGIPK
DVLQVVIGDGEEIGNVFTSSPKIRKITFTGSTPVGKILMKNSADTVKHVSMELGGHAPLI
VDEDADIDLAVEQAMASKYRNAGQTCVCANRLIVHESIKDEFAAKLSEQVSKLKVGNGLE
EGVNVGPIINKRGFEKIVSQIDDAVEKGAKVIAGGTYDRNDDKGCYFVNPTVLTDVDTSM
NIMHEETFGPVAPIVTFSDIDEAIQLANDTPYGLAAYFFTENCRRGIYISENLEYGSIGW
NDGGPSAVQAPFGGMKESGIGREGGSEGIEPYLETKYLSIGL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgccagatcaattaacggtctacaacccggctacgggcgaggagatcaaaacgattcct
cagcaatcagccacagaggtagaagaagccattgaacgttcacatcaagcgtttaaaacg
tggtctaaaacatcagcgaacgaaagagcgtctcttttgaaaaaatggtatgagctgatt
gttgaacataaagaagagcttgcagatttaattacaaaggaaaacggaaaaccataccag
gaagcagtcggcgaggtactttacggcgcaggctatatcgaatggttcgcagaggaagcg
aagcgtgtgtacggaagaacggtcccggccccgacaactggtaaacgaattgttgtcaca
cgccagccggtcggccccgttgctgctatcacgccctggaatttcccgaatgcgatgatt
acacgcaaagcggcgcctgctcttgccgctggctgtacatttatcatcaagccggcgcca
gacacaccgctgtctgcttatgaactagcgcgcctcgcatatgaagctggcattccgaag
gatgttcttcaggttgtgatcggtgatggagaagaaatcggaaatgtgttcacaagcagt
ccgaaaatccgcaaaatcacgtttacaggctcaacacctgtagggaaaatccttatgaaa
aacagcgcggacaccgtgaagcacgtctcaatggaactcggcggacatgccccgctgatc
gtagatgaagatgcagacattgaccttgccgttgaacaggcgatggcgtccaaataccga
aacgccggccaaacctgcgtatgtgccaaccgcctgatcgttcatgagtccatcaaggat
gaatttgctgcgaaactgagcgagcaagtgtctaagctgaaagtcggaaatggacttgag
gaaggcgtcaatgtcggaccgatcatcaacaaacgaggcttcgaaaaaatcgtcagccaa
atagatgatgcggttgaaaaaggcgcaaaagtgattgctgggggcacatatgaccgaaac
gatgacaaagggtgctactttgtgaatccgacagtgctcaccgatgtcgatacgtccatg
aacatcatgcatgaggaaacattcggcccggtcgccccgatcgtcacgttttctgatatt
gatgaagcgattcagcttgccaacgatacaccgtatggcttggctgcatacttcttcaca
gaaaactgccgccgcggcatctatatttccgagaatctagagtatggcagtatcggctgg
aatgacggcggaccgtcagcggttcaagcgccattcggcggaatgaaagaaagcggcatt
ggccgtgaaggcggttcagaaggtatcgagccgtaccttgaaacaaaatatttgtccatc
ggtttataa

DBGET integrated database retrieval system