KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01995Help
Entry
I653_01995        CDS       T02520                                 

Definition
(GenBank) glucose uptake protein
  KO
K05340  
glucose uptake protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Brite
Transporters [BR:bsy02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   I653_01995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
435541..436404
Genome map
AA seq 287 aa AA seqDB search
MDLLLALLPALFWGSIVLFNVKLGGGPYSQTLGTTIGALIVSIVIYFFVQPVLSLRIFIV
GIVSGLFWSLGQANQLKSIQLMGVSKTMPISTGMQLVSTSLFGVIVFREWSTPIAITLGV
LALIFIIVGIILTSLEDKNDKKEGEPSNLKKGILILLVSTLGYLVYVVVARLFNVSGWSA
LLPQAIGMVVGGLVLTYRHKPFNKYAIRNILPGLIWAGGNMFLFISQPRVGVATSFSLSQ
MGIVISTLGGIFILREKKTKRQLIAIAIGIILIIAAAVFLGIAKTNS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggatttattattggctcttctcccggctttgttttgggggagcattgttctcttcaat
gtgaaattaggcggcgggccgtacagccagacactgggaacgacgatcggggcactcatt
gtttctatcgttatttacttttttgttcagcccgttctgtcacttcgcatttttattgtt
ggaatcgtatccggcttattttggtcacttggacaggccaaccagctgaaaagcattcaa
ttgatgggcgtgtcgaaaacaatgccgatttctacaggaatgcagctcgtttccacctcg
ctgttcggtgtgatcgtgttccgcgaatggtcaacaccgattgcgattacgcttggcgtt
ctcgctttgatctttatcattgtgggaatcattctcacgtccttggaagataagaatgat
aaaaaagagggcgagccaagcaatttgaaaaagggcattttgattctccttgtttcgact
cttggttatttggtttatgtagtcgtggctagattattcaatgtgtccggctggtccgcg
ctgctgccacaggcaattggcatggtggtcggggggttagttttaacctatagacacaaa
ccctttaacaagtatgcgatcagaaatattctcccagggttaatctgggcaggcggaaat
atgtttttgtttatttctcagccgcgagtcggcgttgcaacgagcttttccctttcacaa
atgggaattgtcatttctacgctcggcggtattttcatcctgcgtgaaaagaaaacgaaa
cgccagcttatagcaattgcgatagggattatcctgattattgccgctgccgtattctta
ggaatcgccaaaacaaattcataa

DBGET integrated database retrieval system