KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_02035Help
Entry
I653_02035        CDS       T02520                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  
mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    I653_02035
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     I653_02035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
442698..443819
Genome map
AA seq 373 aa AA seqDB search
MIALHFGAGNIGRGFIGALLHHSGYDVVFADVNDTMVSLLNEKKEYTVELAEEGRSSEVI
GPVSAINSGSQPEELYRLMNEAALITTAVGPNVLKLIAPSIAEGLRRRNAANTLNIIACE
NMIGGSSFLKKEIYSHLTEAEQKSVSETVGFPNSAVDRIVPIQHHEDPLKVSVEPFFEWV
IDESGFKGKTPVINGALFVDDLTPYIERKLFTVNTGHAVTAYVGYQRGLKTVKEAIDHPE
IRRVVHSALLETGDYLVKSYGFKQTEHEQYIKKIIGRFENPFISDDVTRVARSPLRKLGE
NDRLVGPAKKIKEPNALAEGIAAALRFDFAGDPEAVELQALIEEKGYSGVLQEVCGIQSH
EPLHAIILKKLNQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccttacatttcggtgcggggaatattgggagagggtttatcggcgcgctgctt
caccactccggctatgatgtggtgtttgcggatgtaaacgacacgatggtcagcctcctc
aacgaaaaaaaagaatacacagtcgaactggcagaagagggacgttcatcagaggtcatt
ggcccggtcagcgcgattaacagcggcagtcagcccgaagagctgtatcggctgatgaat
gaggcggcgctcatcacaacagctgtcggcccgaacgtgctgaagctgattgctccgtcg
atcgcagaaggcttaagacggagaaacgctgcaaacacactgaatatcattgcctgcgaa
aatatgattggcggaagcagcttcttaaagaaagaaatatacagccatttaacggaagca
gagcagaaatccgtcagtgaaacggtaggttttccgaattctgccgttgaccggatcgtc
ccgattcagcatcatgaagacccgctgaaagtatcggttgaaccatttttcgaatgggtc
attgatgaatcaggctttaaagggaaaacaccagtcataaacggcgcactgtttgttgat
gatttaaccccgtacatcgaacggaagctgtttacggtcaataccggacacgcggtgaca
gcgtatgtcggctatcagcgcggactcaaaacggtcaaagaagcaatcgatcatccggaa
atccgccgtgttgttcattcggcgctgcttgaaactggtgactatctcgtcaaatcgtat
ggctttaagcaaactgaacacgaacaatatatcaaaaaaatcatcggtcgctttgaaaat
cctttcatttcggacgatgtgacccgcgtagcgaggtcacctctcagaaaactgggagaa
aatgatagacttgtaggcccggcaaagaaaataaaagaaccgaatgcactggcggaagga
attgccgcagcactgcgcttcgatttcgccggtgatcctgaagcggttgaactgcaagcg
ctgatcgaagaaaaaggatacagcggcgtacttcaagaggtgtgcggcattcagtcccat
gaaccgttgcacgccatcattttaaagaaacttaatcaataa

DBGET integrated database retrieval system