KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_02055Help
Entry
I653_02055        CDS       T02520                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
446434..446826
Genome map
AA seq 130 aa AA seqDB search
MNSLSLPHRYPFLFIDGVTDSEPGKHAAAYKLISENDWFITDTQTEMPFSLVIEALAQTA
AFTGITDENSLGLLSSVKKAEKLGEAAPGDRLDLTFEVTRNRRGFVFGHAKASVGEQPVA
EAEIGIYIEK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaactcattatctttgcctcaccgctatccatttttgtttattgatggcgtgacggat
agcgagcccggcaaacacgcggcagcttataagctgattagtgagaacgactggtttatc
actgatacgcaaacagaaatgccgttttcacttgtgattgaagcgcttgcgcaaaccgcg
gcttttacaggaattacagatgagaacagcttgggattattgtcttcggtgaagaaagcg
gaaaagctgggagaagctgcgcccggtgaccggcttgatcttacgtttgaagtcacgcgc
aatcggcgcgggtttgtgttcggacatgccaaggcatcagttggagagcagcctgttgct
gaagctgaaatcggcatctatattgaaaaatga

DBGET integrated database retrieval system