KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_02065Help
Entry
I653_02065        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
  KO
K21064  
5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase [EC:3.1.3.104]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    I653_02065
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.104  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
     I653_02065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
447156..447905
Genome map
AA seq 249 aa AA seqDB search
MSVQREDVDIKLIAIDMDGTLLNDEQLISDENRKAIREAEDKGVYVVISTGRTLMTCREL
AESLKLSSFLITANGSEIWDSNFNLVERKLLHTDHIQMMWDLRNKHNTNFWASTVNKVWR
GEFPENITDHEWLKFGFDIEDDDIRNEVLEELRKNKELEITNSSPTNIEVNALGINKAAA
LAKVTEKLGFTMENVMAMGDSLNDIAMIKEAGLGVAMGNAQDIVKETADYITDTNIEDGV
AKAIRHWVL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcaaagagaagatgtagatatcaagctgatcgcaattgatatggatggtaca
ctgctgaacgacgagcagctgatctcggatgaaaaccgcaaagccattcgtgaagcggag
gataaaggtgtgtatgtggtgatcagcacgggccggacgctgatgacgtgccgggagctg
gcggaatcgctaaagctgtcatcctttctaatcacggcaaacggaagtgaaatttgggat
tcgaattttaatttggtggaacggaagctgctccatacggaccatattcaaatgatgtgg
gatttgcggaataagcacaacactaatttctgggcctctacggtgaataaagtatggaga
ggcgagtttccggaaaacattacggatcatgaatggctcaaattcggctttgacatcgag
gatgatgatatccgaaatgaagtgctggaggagctgagaaaaaacaaagagcttgaaatc
acaaattcaagtccgacaaacattgaagtcaacgcgcttggcatcaacaaagctgcagcc
cttgccaaggttacggaaaaactcggctttacaatggagaatgtgatggcgatgggtgac
agccttaatgacattgcgatgatcaaagaagcgggtcttggcgtcgcaatgggcaatgcg
caagacatcgtaaaagaaacggctgattatatcacggatacaaatattgaggatggtgtc
gctaaagcgattcgccattgggtactataa

DBGET integrated database retrieval system