KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_02070Help
Entry
I653_02070        CDS       T02520                                 

Definition
(GenBank) LamB/YcsF family protein
  KO
K07160  
UPF0271 protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
448112..448885
Genome map
AA seq 257 aa AA seqDB search
MFQIDLNCDLGESFGAYKIGLDQDILEYVTSANIACGFHAGDPSVMRKTVALAAEKGVKI
GAHPGLPDLLGFGRRNMAISPEEAYDLVVYQIGALSGFLKAEGLHMQHVKPHGALYNMAA
VDQKLSDAIAKAVYKIDPGLILFGLAESELVKAGERIGLQTANEVFADRTYQSDGTLTPR
SQPDALIESDDAAVTQVIEMVKEGAVKSQQGHDVPLKADTVCIHGDGAHALTFAQKIRKQ
LKAAGIEVTAISEQKST
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcagattgatttaaactgtgatttaggagaaagcttcggagcctacaagataggc
cttgaccaagatattttagagtatgtgacatcagcgaatatcgcatgcggatttcatgca
ggagatcctagtgttatgcgaaaaaccgtcgcgcttgcagcggaaaaaggcgtaaaaatc
ggcgcgcacccgggcttgccggatttactcggttttgggcgccgcaatatggcgatttct
cctgaggaagcgtatgatcttgtcgtttatcaaattggcgcgctctctggctttctaaaa
gcagagggacttcacatgcagcacgtcaagccgcatggcgctttatacaatatggcggca
gtcgatcaaaaactgtcggatgctatcgcgaaagctgtctataagattgatccaggcctg
attcttttcggtcttgctgagagcgagcttgtaaaagcgggagaacggatcggacttcag
accgcaaatgaagtgttcgccgacagaacataccaatcggacggcacgctgacaccgcgc
tcccagccggacgcactcattgaaagtgatgatgccgccgtcacccaggtcatcgaaatg
gtgaaagaaggggcggtcaaatctcagcaaggacatgatgtgccattaaaagcagataca
gtctgcattcatggagatggagcccatgcgctgacatttgcgcaaaaaatcagaaaacag
ctcaaagcggctggaattgaagtgacagctatttcagaacagaagtcaacataa

DBGET integrated database retrieval system